Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6R2Z5

Protein Details
Accession A0A2Z6R2Z5    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
57-83NDLVHQLQRHKRQKRIVYNPVRERYYNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MGCSIHDQFMLHKENSKEKDKEKSQEISEISEIAFLASRPNLSMDNYNRTILLEAVNDLVHQLQRHKRQKRIVYNPVRERYYNTECK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.51
4 0.49
5 0.49
6 0.58
7 0.59
8 0.62
9 0.59
10 0.59
11 0.53
12 0.54
13 0.5
14 0.43
15 0.36
16 0.3
17 0.24
18 0.18
19 0.16
20 0.1
21 0.09
22 0.05
23 0.06
24 0.06
25 0.06
26 0.06
27 0.07
28 0.08
29 0.09
30 0.14
31 0.16
32 0.21
33 0.23
34 0.23
35 0.21
36 0.21
37 0.2
38 0.15
39 0.14
40 0.08
41 0.07
42 0.08
43 0.08
44 0.07
45 0.07
46 0.07
47 0.08
48 0.08
49 0.15
50 0.22
51 0.33
52 0.44
53 0.51
54 0.59
55 0.67
56 0.77
57 0.81
58 0.83
59 0.84
60 0.85
61 0.87
62 0.89
63 0.87
64 0.81
65 0.71
66 0.67
67 0.64