Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QP54

Protein Details
Accession A0A2Z6QP54    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
43-67SGDNEKKEKPKKPPIRKVNLPRSIKBasic
71-94VEVEKPKLSKRMKRVKNNLRIDMVHydrophilic
NLS Segment(s)
PositionSequence
48-86KKEKPKKPPIRKVNLPRSIKKKPVEVEKPKLSKRMKRVK
107-112LKKRRK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 8
Family & Domain DBs
Amino Acid Sequences MTKRNNQRSGNTQIVESPLLDMNFDFADAPPATRIKPNNNNESGDNEKKEKPKKPPIRKVNLPRSIKKKPVEVEKPKLSKRMKRVKNNLRIDMVGYEQKHYATRSSLKKRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.35
3 0.28
4 0.22
5 0.16
6 0.16
7 0.15
8 0.13
9 0.12
10 0.11
11 0.11
12 0.09
13 0.06
14 0.11
15 0.11
16 0.12
17 0.12
18 0.13
19 0.14
20 0.19
21 0.22
22 0.27
23 0.37
24 0.43
25 0.49
26 0.52
27 0.53
28 0.49
29 0.51
30 0.49
31 0.43
32 0.39
33 0.34
34 0.35
35 0.4
36 0.47
37 0.48
38 0.5
39 0.57
40 0.66
41 0.73
42 0.79
43 0.82
44 0.83
45 0.86
46 0.87
47 0.86
48 0.85
49 0.8
50 0.76
51 0.74
52 0.72
53 0.7
54 0.63
55 0.59
56 0.55
57 0.59
58 0.63
59 0.64
60 0.66
61 0.67
62 0.72
63 0.68
64 0.72
65 0.69
66 0.66
67 0.68
68 0.7
69 0.71
70 0.74
71 0.83
72 0.84
73 0.87
74 0.88
75 0.84
76 0.76
77 0.67
78 0.58
79 0.49
80 0.42
81 0.37
82 0.29
83 0.25
84 0.23
85 0.23
86 0.24
87 0.24
88 0.23
89 0.23
90 0.31
91 0.4
92 0.5