Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RQ80

Protein Details
Accession A0A2Z6RQ80    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
14-37LYNNDKRKKSTSRIKEKDNRVMKTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 10
Family & Domain DBs
Amino Acid Sequences MSNATKRKCVTNILYNNDKRKKSTSRIKEKDNRVMKTFLVLPSTDYMKVIVFGCQVIGLQMNLYAMDVLTPEIYRFRIIDKVSFPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.66
3 0.72
4 0.72
5 0.68
6 0.61
7 0.6
8 0.61
9 0.62
10 0.66
11 0.67
12 0.7
13 0.75
14 0.81
15 0.82
16 0.82
17 0.82
18 0.8
19 0.73
20 0.65
21 0.6
22 0.49
23 0.42
24 0.37
25 0.28
26 0.21
27 0.17
28 0.15
29 0.14
30 0.16
31 0.13
32 0.11
33 0.1
34 0.08
35 0.1
36 0.09
37 0.08
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.05
44 0.06
45 0.05
46 0.04
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.04
56 0.05
57 0.06
58 0.06
59 0.08
60 0.1
61 0.11
62 0.12
63 0.14
64 0.2
65 0.22
66 0.26