Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RLU2

Protein Details
Accession A0A2Z6RLU2    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-24ILSNMKDYKKHKVRKLDPAEKIIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 6.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MILSNMKDYKKHKVRKLDPAEKIILHIDEIKDAKRFNRLNSTPQWPFIVLITGRINSEKTNEVVNLLLENKLYRMFNGKKGRTRYIQNDDLVLIGHHLNKPKYRYLKSGYQIISNSPKPYREDISFRAMKPDKIPKLDSFSPERGTVVIFEDVCADSKKVQEKIAHYFTEERHRNISSMYVSQSFFDCLKLIRKNLNYVVLFNGSTSEELSRILRLYAYDWRSIYKDVVNYLID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.88
4 0.87
5 0.83
6 0.8
7 0.75
8 0.64
9 0.57
10 0.49
11 0.38
12 0.3
13 0.27
14 0.21
15 0.21
16 0.23
17 0.23
18 0.23
19 0.24
20 0.25
21 0.31
22 0.33
23 0.34
24 0.43
25 0.44
26 0.48
27 0.53
28 0.6
29 0.53
30 0.52
31 0.48
32 0.38
33 0.35
34 0.28
35 0.28
36 0.19
37 0.21
38 0.21
39 0.19
40 0.19
41 0.2
42 0.2
43 0.15
44 0.18
45 0.16
46 0.15
47 0.16
48 0.16
49 0.16
50 0.15
51 0.14
52 0.13
53 0.12
54 0.11
55 0.09
56 0.09
57 0.09
58 0.11
59 0.11
60 0.1
61 0.18
62 0.2
63 0.29
64 0.39
65 0.44
66 0.49
67 0.55
68 0.6
69 0.56
70 0.6
71 0.6
72 0.58
73 0.57
74 0.51
75 0.46
76 0.4
77 0.35
78 0.28
79 0.19
80 0.12
81 0.08
82 0.09
83 0.1
84 0.14
85 0.16
86 0.19
87 0.23
88 0.28
89 0.35
90 0.36
91 0.4
92 0.42
93 0.48
94 0.47
95 0.51
96 0.45
97 0.4
98 0.38
99 0.35
100 0.35
101 0.28
102 0.28
103 0.22
104 0.23
105 0.23
106 0.26
107 0.26
108 0.24
109 0.27
110 0.27
111 0.33
112 0.35
113 0.32
114 0.38
115 0.36
116 0.34
117 0.34
118 0.4
119 0.37
120 0.37
121 0.41
122 0.34
123 0.4
124 0.42
125 0.4
126 0.37
127 0.35
128 0.34
129 0.31
130 0.29
131 0.22
132 0.2
133 0.17
134 0.13
135 0.12
136 0.1
137 0.1
138 0.11
139 0.11
140 0.12
141 0.12
142 0.1
143 0.1
144 0.14
145 0.19
146 0.2
147 0.24
148 0.27
149 0.31
150 0.38
151 0.41
152 0.38
153 0.34
154 0.36
155 0.34
156 0.41
157 0.4
158 0.35
159 0.34
160 0.35
161 0.33
162 0.3
163 0.31
164 0.24
165 0.22
166 0.23
167 0.22
168 0.21
169 0.21
170 0.22
171 0.2
172 0.17
173 0.16
174 0.14
175 0.13
176 0.2
177 0.25
178 0.28
179 0.34
180 0.36
181 0.42
182 0.45
183 0.51
184 0.44
185 0.4
186 0.4
187 0.34
188 0.31
189 0.25
190 0.22
191 0.15
192 0.14
193 0.14
194 0.12
195 0.1
196 0.11
197 0.13
198 0.13
199 0.13
200 0.13
201 0.12
202 0.12
203 0.15
204 0.22
205 0.24
206 0.27
207 0.27
208 0.3
209 0.32
210 0.34
211 0.33
212 0.29
213 0.29
214 0.27