Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RN38

Protein Details
Accession A0A2Z6RN38    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
26-56HAWEKARNITRKKKIKYRKKNKKGNSAPTSDHydrophilic
NLS Segment(s)
PositionSequence
31-49ARNITRKKKIKYRKKNKKG
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
Amino Acid Sequences MIIFFMELFFKDITRPFWKLHSSLMHAWEKARNITRKKKIKYRKKNKKGNSAPTSDNPTSQLRTLRRTIQQVDNSSSSHIHGFNATTPQKSIPRNPFKFDRKLFIYLNSSNYLHSGDCAYFNFYGSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.27
4 0.33
5 0.37
6 0.36
7 0.4
8 0.39
9 0.39
10 0.4
11 0.45
12 0.43
13 0.39
14 0.39
15 0.37
16 0.34
17 0.34
18 0.38
19 0.4
20 0.45
21 0.55
22 0.63
23 0.69
24 0.75
25 0.79
26 0.82
27 0.85
28 0.88
29 0.89
30 0.9
31 0.91
32 0.94
33 0.92
34 0.93
35 0.91
36 0.9
37 0.85
38 0.78
39 0.71
40 0.64
41 0.63
42 0.51
43 0.42
44 0.34
45 0.3
46 0.27
47 0.25
48 0.28
49 0.22
50 0.26
51 0.28
52 0.29
53 0.31
54 0.34
55 0.37
56 0.38
57 0.41
58 0.4
59 0.41
60 0.38
61 0.34
62 0.31
63 0.27
64 0.21
65 0.17
66 0.14
67 0.11
68 0.1
69 0.11
70 0.11
71 0.18
72 0.19
73 0.18
74 0.18
75 0.22
76 0.27
77 0.3
78 0.37
79 0.4
80 0.5
81 0.53
82 0.58
83 0.64
84 0.65
85 0.71
86 0.66
87 0.63
88 0.57
89 0.58
90 0.54
91 0.5
92 0.49
93 0.42
94 0.43
95 0.39
96 0.35
97 0.3
98 0.29
99 0.26
100 0.19
101 0.17
102 0.16
103 0.13
104 0.15
105 0.16
106 0.18
107 0.17