Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RAA6

Protein Details
Accession A0A2Z6RAA6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-38QKINLDNSKRIRKKPPKPCPDCKETIHydrophilic
NLS Segment(s)
PositionSequence
22-27RIRKKP
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MSHRQNRTQPYIQKINLDNSKRIRKKPPKPCPDCKETIDCVKLISNKVDKIEEIINNFKNLHLQKKKSIKLSKFNAKFTLNNVPCEVEYDLPNFTVESLQKLLVITTQLYNPNSSPSDDSESSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.61
3 0.61
4 0.58
5 0.57
6 0.56
7 0.65
8 0.65
9 0.68
10 0.7
11 0.73
12 0.79
13 0.83
14 0.86
15 0.86
16 0.88
17 0.92
18 0.88
19 0.85
20 0.8
21 0.73
22 0.68
23 0.61
24 0.59
25 0.5
26 0.42
27 0.35
28 0.33
29 0.31
30 0.26
31 0.27
32 0.24
33 0.24
34 0.26
35 0.25
36 0.22
37 0.21
38 0.23
39 0.2
40 0.19
41 0.23
42 0.22
43 0.22
44 0.22
45 0.2
46 0.22
47 0.22
48 0.28
49 0.3
50 0.32
51 0.39
52 0.48
53 0.52
54 0.56
55 0.63
56 0.59
57 0.62
58 0.68
59 0.7
60 0.66
61 0.65
62 0.6
63 0.55
64 0.5
65 0.44
66 0.47
67 0.38
68 0.35
69 0.33
70 0.3
71 0.27
72 0.29
73 0.26
74 0.16
75 0.16
76 0.15
77 0.15
78 0.14
79 0.14
80 0.11
81 0.1
82 0.12
83 0.11
84 0.13
85 0.14
86 0.13
87 0.14
88 0.14
89 0.14
90 0.12
91 0.13
92 0.11
93 0.11
94 0.14
95 0.19
96 0.2
97 0.22
98 0.21
99 0.25
100 0.25
101 0.26
102 0.26
103 0.25
104 0.32