Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QEY2

Protein Details
Accession A0A2Z6QEY2    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
68-93DYNLKQQLRKRQQQEKLKQRRKFVGQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MFYSWFDREQNVNLIDSTKRCDCKFCELEHENLQISSFFGQRIDRKLEQKQQYSSREELSITHLSTLDYNLKQQLRKRQQQEKLKQRRKFVGQDNNFSNNLQKFISLYKNSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.24
4 0.26
5 0.26
6 0.3
7 0.29
8 0.34
9 0.36
10 0.43
11 0.46
12 0.42
13 0.46
14 0.44
15 0.48
16 0.47
17 0.46
18 0.36
19 0.32
20 0.3
21 0.2
22 0.18
23 0.14
24 0.1
25 0.08
26 0.09
27 0.12
28 0.15
29 0.19
30 0.25
31 0.27
32 0.31
33 0.38
34 0.46
35 0.49
36 0.51
37 0.53
38 0.54
39 0.55
40 0.54
41 0.49
42 0.41
43 0.35
44 0.3
45 0.25
46 0.23
47 0.2
48 0.16
49 0.15
50 0.14
51 0.13
52 0.13
53 0.15
54 0.14
55 0.12
56 0.13
57 0.18
58 0.2
59 0.24
60 0.29
61 0.39
62 0.44
63 0.53
64 0.61
65 0.65
66 0.72
67 0.79
68 0.85
69 0.85
70 0.87
71 0.88
72 0.85
73 0.83
74 0.82
75 0.79
76 0.77
77 0.76
78 0.76
79 0.73
80 0.75
81 0.73
82 0.69
83 0.62
84 0.54
85 0.5
86 0.41
87 0.36
88 0.28
89 0.23
90 0.2
91 0.24
92 0.32