Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CQP5

Protein Details
Accession A1CQP5    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
326-353YYSAYRETSKRCRKKAARAGGWRRWLFRHydrophilic
NLS Segment(s)
PositionSequence
338-344RKKAARA
Subcellular Location(s) mito 9, cyto 8.5, cyto_nucl 6, pero 4, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018108  Mitochondrial_sb/sol_carrier  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
KEGG act:ACLA_026880  -  
Pfam View protein in Pfam  
PF00153  Mito_carr  
PROSITE View protein in PROSITE  
PS50920  SOLCAR  
Amino Acid Sequences MSNQIGFDDLDFVTEIGKAPRRNPRNDAATGASAAGVRAVSAQMVAFYFRAPIKAFFRTRVDYMAYARAVYPHSTGKRWSLHTTTPGLIVHAVRTYGWRFIPNQILPPLLANAGIGAVLYTSYLQTLGILYEPISRGVKRVYPPASPFHTFAAGCAAGTIQSIVAAPLDALQIRLRANDMLQGQYRSMWHYGQCKLREIGIRGIFTGWSLSLLRDSLGYAVFFCSFEYIKSQAYYSFITRFYGSLPAHHLDKLQSSDSSDRGVPLIKPHYSLEPCFLMFAGVAASIAQQAVQHPLGVVQGIHYARLEYLDHQVNLLSSQGRMMRVYYSAYRETSKRCRKKAARAGGWRRWLFRGFAGSAIRQVPSTSAGLVIFELVRRKYANPADAIYIRKDGYDILLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.15
4 0.22
5 0.24
6 0.31
7 0.41
8 0.49
9 0.56
10 0.61
11 0.65
12 0.65
13 0.65
14 0.62
15 0.56
16 0.5
17 0.43
18 0.37
19 0.28
20 0.21
21 0.18
22 0.14
23 0.09
24 0.07
25 0.07
26 0.07
27 0.06
28 0.06
29 0.06
30 0.06
31 0.07
32 0.09
33 0.08
34 0.08
35 0.11
36 0.11
37 0.14
38 0.15
39 0.2
40 0.24
41 0.32
42 0.35
43 0.38
44 0.43
45 0.45
46 0.44
47 0.42
48 0.41
49 0.35
50 0.35
51 0.35
52 0.3
53 0.26
54 0.24
55 0.23
56 0.22
57 0.21
58 0.2
59 0.23
60 0.26
61 0.27
62 0.3
63 0.35
64 0.39
65 0.42
66 0.45
67 0.42
68 0.43
69 0.46
70 0.47
71 0.41
72 0.38
73 0.33
74 0.28
75 0.25
76 0.2
77 0.17
78 0.14
79 0.13
80 0.11
81 0.14
82 0.15
83 0.17
84 0.18
85 0.19
86 0.2
87 0.25
88 0.33
89 0.31
90 0.34
91 0.31
92 0.31
93 0.28
94 0.27
95 0.23
96 0.15
97 0.13
98 0.08
99 0.07
100 0.06
101 0.05
102 0.04
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.05
115 0.05
116 0.05
117 0.05
118 0.08
119 0.08
120 0.11
121 0.12
122 0.12
123 0.13
124 0.15
125 0.2
126 0.2
127 0.27
128 0.28
129 0.3
130 0.33
131 0.37
132 0.4
133 0.38
134 0.37
135 0.31
136 0.31
137 0.26
138 0.23
139 0.22
140 0.17
141 0.14
142 0.13
143 0.11
144 0.08
145 0.08
146 0.08
147 0.03
148 0.03
149 0.03
150 0.04
151 0.04
152 0.03
153 0.03
154 0.04
155 0.04
156 0.04
157 0.05
158 0.06
159 0.08
160 0.08
161 0.08
162 0.09
163 0.09
164 0.09
165 0.12
166 0.13
167 0.13
168 0.15
169 0.15
170 0.14
171 0.15
172 0.16
173 0.14
174 0.14
175 0.13
176 0.14
177 0.18
178 0.23
179 0.29
180 0.3
181 0.3
182 0.29
183 0.31
184 0.32
185 0.29
186 0.31
187 0.28
188 0.26
189 0.24
190 0.24
191 0.2
192 0.17
193 0.14
194 0.07
195 0.06
196 0.06
197 0.06
198 0.06
199 0.06
200 0.06
201 0.06
202 0.06
203 0.06
204 0.06
205 0.06
206 0.05
207 0.06
208 0.07
209 0.06
210 0.06
211 0.07
212 0.07
213 0.07
214 0.1
215 0.11
216 0.11
217 0.12
218 0.12
219 0.11
220 0.14
221 0.15
222 0.14
223 0.15
224 0.15
225 0.15
226 0.15
227 0.15
228 0.14
229 0.19
230 0.17
231 0.16
232 0.2
233 0.2
234 0.21
235 0.21
236 0.21
237 0.15
238 0.18
239 0.19
240 0.16
241 0.15
242 0.17
243 0.18
244 0.18
245 0.19
246 0.17
247 0.15
248 0.14
249 0.15
250 0.13
251 0.16
252 0.21
253 0.19
254 0.21
255 0.22
256 0.28
257 0.29
258 0.29
259 0.27
260 0.24
261 0.23
262 0.21
263 0.2
264 0.13
265 0.11
266 0.1
267 0.07
268 0.04
269 0.04
270 0.04
271 0.04
272 0.04
273 0.04
274 0.04
275 0.04
276 0.05
277 0.09
278 0.09
279 0.09
280 0.09
281 0.1
282 0.1
283 0.1
284 0.09
285 0.06
286 0.11
287 0.11
288 0.12
289 0.11
290 0.11
291 0.11
292 0.13
293 0.13
294 0.1
295 0.16
296 0.2
297 0.19
298 0.19
299 0.2
300 0.18
301 0.17
302 0.17
303 0.12
304 0.08
305 0.11
306 0.13
307 0.14
308 0.15
309 0.15
310 0.15
311 0.16
312 0.19
313 0.2
314 0.22
315 0.24
316 0.26
317 0.29
318 0.31
319 0.38
320 0.45
321 0.53
322 0.58
323 0.62
324 0.71
325 0.77
326 0.84
327 0.86
328 0.87
329 0.86
330 0.87
331 0.9
332 0.88
333 0.89
334 0.81
335 0.74
336 0.67
337 0.6
338 0.51
339 0.44
340 0.42
341 0.33
342 0.35
343 0.35
344 0.31
345 0.32
346 0.32
347 0.28
348 0.22
349 0.22
350 0.18
351 0.17
352 0.18
353 0.14
354 0.13
355 0.13
356 0.13
357 0.13
358 0.13
359 0.1
360 0.11
361 0.16
362 0.16
363 0.19
364 0.2
365 0.22
366 0.3
367 0.37
368 0.4
369 0.38
370 0.4
371 0.43
372 0.45
373 0.47
374 0.41
375 0.37
376 0.32
377 0.28
378 0.26
379 0.21