Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6Q1H8

Protein Details
Accession A0A2Z6Q1H8    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
34-61VTPLTKSQKRSAKKKARKEKQKLQLQTLHydrophilic
NLS Segment(s)
PositionSequence
40-54SQKRSAKKKARKEKQ
Subcellular Location(s) nucl 18, cyto_nucl 12.333, mito_nucl 11.499, mito 3.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MNFDVFDTNLIGSLDDVNDVLVSTPPHKVTPIPVTPLTKSQKRSAKKKARKEKQKLQLQTLTGLDERVVPTFSKESPEYTPSKPSGSRTVTFDQSILSPPSTPYKQQLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.06
5 0.06
6 0.06
7 0.06
8 0.07
9 0.08
10 0.09
11 0.12
12 0.13
13 0.14
14 0.15
15 0.15
16 0.19
17 0.26
18 0.27
19 0.29
20 0.31
21 0.33
22 0.34
23 0.41
24 0.42
25 0.39
26 0.4
27 0.43
28 0.48
29 0.53
30 0.62
31 0.65
32 0.7
33 0.74
34 0.81
35 0.85
36 0.87
37 0.9
38 0.9
39 0.89
40 0.88
41 0.88
42 0.81
43 0.75
44 0.69
45 0.59
46 0.51
47 0.41
48 0.33
49 0.24
50 0.2
51 0.14
52 0.11
53 0.11
54 0.09
55 0.1
56 0.08
57 0.1
58 0.12
59 0.12
60 0.15
61 0.16
62 0.18
63 0.2
64 0.25
65 0.27
66 0.27
67 0.32
68 0.3
69 0.33
70 0.33
71 0.33
72 0.38
73 0.39
74 0.39
75 0.4
76 0.43
77 0.42
78 0.41
79 0.37
80 0.29
81 0.25
82 0.26
83 0.22
84 0.19
85 0.16
86 0.17
87 0.25
88 0.28
89 0.3