Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6S216

Protein Details
Accession A0A2Z6S216    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGQRLSKRIKRKKSLSQPRSIDSHydrophilic
NLS Segment(s)
PositionSequence
7-13KRIKRKK
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
Amino Acid Sequences MGQRLSKRIKRKKSLSQPRSIDSDTDSNSNTSTKIVLQEHERTSIYFTYLRGLFNSEFSAPIDDVLILNGKIMETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.89
3 0.89
4 0.83
5 0.76
6 0.73
7 0.62
8 0.52
9 0.44
10 0.4
11 0.31
12 0.28
13 0.25
14 0.19
15 0.19
16 0.19
17 0.15
18 0.11
19 0.1
20 0.09
21 0.12
22 0.12
23 0.13
24 0.17
25 0.21
26 0.22
27 0.24
28 0.23
29 0.19
30 0.21
31 0.19
32 0.18
33 0.14
34 0.13
35 0.15
36 0.16
37 0.16
38 0.14
39 0.18
40 0.16
41 0.16
42 0.18
43 0.14
44 0.14
45 0.15
46 0.17
47 0.13
48 0.13
49 0.12
50 0.1
51 0.1
52 0.1
53 0.11
54 0.08
55 0.09
56 0.09