Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QEK3

Protein Details
Accession A0A2Z6QEK3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
158-182YVDKYAPKKGQKNLKIKLKNNIKQLHydrophilic
NLS Segment(s)
PositionSequence
93-97RIRRR
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR020568  Ribosomal_S5_D2-typ_fold  
IPR014721  Ribosomal_S5_D2-typ_fold_subgr  
IPR000100  RNase_P  
Gene Ontology GO:0004526  F:ribonuclease P activity  
GO:0000049  F:tRNA binding  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF00825  Ribonuclease_P  
Amino Acid Sequences MMKKNGRDPNLPPLLPKKDTHSIDTDTIHKMITDKKNNITGITYTDYFKLAARKWRENDTYFTKKTKEPIKNFRLQIVVSKKNVSKLAVVRARIRRRIRESARFALPVVGRERHDYLFFANLKSYDAPWLQLCSAVESAIGNPKLYSIGKSHGGGSGYVDKYAPKKGQKNLKIKLKNNIKQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.54
3 0.51
4 0.48
5 0.49
6 0.51
7 0.51
8 0.47
9 0.44
10 0.44
11 0.45
12 0.4
13 0.34
14 0.31
15 0.27
16 0.22
17 0.2
18 0.25
19 0.33
20 0.38
21 0.4
22 0.45
23 0.51
24 0.51
25 0.5
26 0.44
27 0.35
28 0.29
29 0.29
30 0.25
31 0.2
32 0.2
33 0.19
34 0.17
35 0.18
36 0.2
37 0.19
38 0.27
39 0.33
40 0.4
41 0.43
42 0.5
43 0.54
44 0.51
45 0.53
46 0.53
47 0.55
48 0.5
49 0.49
50 0.44
51 0.41
52 0.45
53 0.49
54 0.5
55 0.5
56 0.58
57 0.62
58 0.68
59 0.66
60 0.62
61 0.55
62 0.45
63 0.44
64 0.42
65 0.39
66 0.32
67 0.35
68 0.33
69 0.35
70 0.36
71 0.3
72 0.25
73 0.23
74 0.3
75 0.3
76 0.31
77 0.34
78 0.41
79 0.45
80 0.5
81 0.52
82 0.51
83 0.55
84 0.63
85 0.63
86 0.64
87 0.66
88 0.63
89 0.61
90 0.53
91 0.47
92 0.41
93 0.34
94 0.28
95 0.25
96 0.22
97 0.2
98 0.23
99 0.25
100 0.22
101 0.22
102 0.19
103 0.17
104 0.21
105 0.2
106 0.18
107 0.17
108 0.16
109 0.17
110 0.17
111 0.16
112 0.14
113 0.13
114 0.14
115 0.14
116 0.16
117 0.14
118 0.16
119 0.16
120 0.15
121 0.15
122 0.13
123 0.12
124 0.1
125 0.11
126 0.16
127 0.16
128 0.14
129 0.13
130 0.14
131 0.17
132 0.17
133 0.18
134 0.14
135 0.17
136 0.21
137 0.22
138 0.23
139 0.23
140 0.23
141 0.21
142 0.22
143 0.26
144 0.23
145 0.23
146 0.22
147 0.22
148 0.24
149 0.31
150 0.34
151 0.35
152 0.43
153 0.51
154 0.62
155 0.69
156 0.77
157 0.79
158 0.83
159 0.84
160 0.82
161 0.84
162 0.85