Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6S9P0

Protein Details
Accession A0A2Z6S9P0    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
38-73QGEKGRKREKMRVSRKDEREREKKERDRKRIGKERGBasic
NLS Segment(s)
PositionSequence
41-73KGRKREKMRVSRKDEREREKKERDRKRIGKERG
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MITLPTLPIKTKILNKIFWTRNVDDLASPTLKYSNFNQGEKGRKREKMRVSRKDEREREKKERDRKRIGKERG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.55
4 0.56
5 0.56
6 0.56
7 0.48
8 0.47
9 0.44
10 0.39
11 0.3
12 0.28
13 0.25
14 0.18
15 0.17
16 0.13
17 0.13
18 0.13
19 0.15
20 0.15
21 0.22
22 0.24
23 0.25
24 0.29
25 0.32
26 0.41
27 0.44
28 0.5
29 0.46
30 0.5
31 0.56
32 0.6
33 0.66
34 0.67
35 0.73
36 0.76
37 0.79
38 0.82
39 0.86
40 0.88
41 0.87
42 0.86
43 0.85
44 0.84
45 0.85
46 0.85
47 0.86
48 0.85
49 0.87
50 0.88
51 0.89
52 0.89
53 0.9