Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6R942

Protein Details
Accession A0A2Z6R942    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
43-78PPPPHIWMKVQKKKKGKKKQKKNKNKQPVSSPQPTIHydrophilic
NLS Segment(s)
PositionSequence
51-68KVQKKKKGKKKQKKNKNK
Subcellular Location(s) nucl 20, cyto 4.5, cyto_pero 3.5
Family & Domain DBs
Amino Acid Sequences MELSQNKYFMEEELPPTDTNSSSEAEESSSMVSYTLYREGDEPPPPHIWMKVQKKKKGKKKQKKNKNKQPVSSPQPTIIPIEITDAQIAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.24
4 0.24
5 0.21
6 0.19
7 0.17
8 0.15
9 0.13
10 0.14
11 0.13
12 0.12
13 0.12
14 0.1
15 0.09
16 0.08
17 0.07
18 0.07
19 0.07
20 0.06
21 0.07
22 0.1
23 0.09
24 0.1
25 0.11
26 0.13
27 0.16
28 0.21
29 0.2
30 0.2
31 0.21
32 0.22
33 0.21
34 0.2
35 0.21
36 0.26
37 0.36
38 0.42
39 0.49
40 0.57
41 0.66
42 0.76
43 0.82
44 0.84
45 0.85
46 0.87
47 0.9
48 0.93
49 0.94
50 0.96
51 0.97
52 0.97
53 0.97
54 0.95
55 0.91
56 0.89
57 0.88
58 0.85
59 0.81
60 0.73
61 0.64
62 0.56
63 0.5
64 0.43
65 0.34
66 0.27
67 0.19
68 0.22
69 0.21
70 0.2