Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6S4R0

Protein Details
Accession A0A2Z6S4R0    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
108-135RIEVRDSKRKVEKRQREKSPKQVLTFENHydrophilic
NLS Segment(s)
PositionSequence
109-126IEVRDSKRKVEKRQREKS
Subcellular Location(s) nucl 18, cyto_nucl 14, cyto 8
Family & Domain DBs
Amino Acid Sequences MFVFIFLSPEEAEYIYISAVLIRRSGFYLKSGTLIRSEPVPDETWALFEGPDEAQTSFKDPGRQNTVHLSKVRGWISRRNFEGLEPLLRQTSYLKAHGFLDANKRWGRIEVRDSKRKVEKRQREKSPKQVLTFEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.08
4 0.07
5 0.08
6 0.09
7 0.09
8 0.1
9 0.1
10 0.11
11 0.14
12 0.16
13 0.15
14 0.15
15 0.18
16 0.17
17 0.2
18 0.21
19 0.19
20 0.19
21 0.19
22 0.18
23 0.16
24 0.17
25 0.15
26 0.16
27 0.17
28 0.15
29 0.17
30 0.16
31 0.15
32 0.14
33 0.13
34 0.1
35 0.08
36 0.09
37 0.07
38 0.08
39 0.08
40 0.08
41 0.09
42 0.09
43 0.12
44 0.13
45 0.14
46 0.21
47 0.21
48 0.26
49 0.32
50 0.33
51 0.31
52 0.37
53 0.38
54 0.35
55 0.35
56 0.32
57 0.27
58 0.33
59 0.33
60 0.29
61 0.29
62 0.34
63 0.39
64 0.42
65 0.41
66 0.38
67 0.36
68 0.32
69 0.35
70 0.28
71 0.25
72 0.2
73 0.19
74 0.17
75 0.17
76 0.17
77 0.13
78 0.17
79 0.17
80 0.2
81 0.19
82 0.2
83 0.21
84 0.23
85 0.23
86 0.21
87 0.26
88 0.26
89 0.31
90 0.31
91 0.31
92 0.29
93 0.33
94 0.34
95 0.32
96 0.39
97 0.44
98 0.52
99 0.6
100 0.62
101 0.66
102 0.72
103 0.73
104 0.75
105 0.76
106 0.78
107 0.8
108 0.88
109 0.91
110 0.92
111 0.93
112 0.93
113 0.93
114 0.9
115 0.84