Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RGA5

Protein Details
Accession A0A2Z6RGA5    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-41AYKPYVQKIKLSNNNKRTRRKPSKLCPDCKDAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MSSKPYESRAYKPYVQKIKLSNNNKRTRRKPSKLCPDCKDANDYIELLSSKVSKIEEIVDNFKNLPKNKTNNKLSLFNAKFSLNNIPCELEYDLSNFTLENLQKLVISTTSNCKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.63
3 0.63
4 0.65
5 0.68
6 0.71
7 0.73
8 0.73
9 0.74
10 0.81
11 0.84
12 0.86
13 0.84
14 0.86
15 0.87
16 0.87
17 0.87
18 0.88
19 0.9
20 0.9
21 0.9
22 0.84
23 0.8
24 0.74
25 0.65
26 0.6
27 0.49
28 0.41
29 0.33
30 0.28
31 0.21
32 0.17
33 0.16
34 0.1
35 0.1
36 0.09
37 0.07
38 0.08
39 0.08
40 0.07
41 0.07
42 0.1
43 0.12
44 0.13
45 0.18
46 0.17
47 0.17
48 0.18
49 0.19
50 0.22
51 0.21
52 0.25
53 0.28
54 0.36
55 0.44
56 0.54
57 0.57
58 0.59
59 0.61
60 0.6
61 0.56
62 0.58
63 0.51
64 0.43
65 0.39
66 0.33
67 0.29
68 0.26
69 0.34
70 0.25
71 0.26
72 0.26
73 0.25
74 0.24
75 0.27
76 0.26
77 0.17
78 0.16
79 0.15
80 0.16
81 0.14
82 0.14
83 0.11
84 0.11
85 0.16
86 0.15
87 0.15
88 0.15
89 0.15
90 0.15
91 0.16
92 0.17
93 0.12
94 0.15
95 0.16