Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6S5I3

Protein Details
Accession A0A2Z6S5I3    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-31TNFRTPLPIKSKKTKDNKSGTTQKTHydrophilic
40-65GQVCPDRKKSDSKKNKSRRKTAVLDDHydrophilic
NLS Segment(s)
PositionSequence
46-59RKKSDSKKNKSRRK
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MDKIKLTNFRTPLPIKSKKTKDNKSGTTQKTQQSNPPKQGQVCPDRKKSDSKKNKSRRKTAVLDDLCMLLKTLIQKLDGKSLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.57
3 0.64
4 0.7
5 0.72
6 0.79
7 0.81
8 0.81
9 0.81
10 0.8
11 0.79
12 0.81
13 0.75
14 0.73
15 0.69
16 0.65
17 0.61
18 0.57
19 0.56
20 0.56
21 0.59
22 0.57
23 0.56
24 0.54
25 0.49
26 0.51
27 0.49
28 0.48
29 0.51
30 0.51
31 0.52
32 0.54
33 0.54
34 0.6
35 0.62
36 0.64
37 0.65
38 0.7
39 0.74
40 0.8
41 0.89
42 0.88
43 0.9
44 0.87
45 0.85
46 0.81
47 0.78
48 0.78
49 0.69
50 0.61
51 0.52
52 0.44
53 0.36
54 0.29
55 0.22
56 0.11
57 0.11
58 0.12
59 0.15
60 0.15
61 0.18
62 0.22
63 0.24