Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RZ80

Protein Details
Accession A0A2Z6RZ80    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
93-122LRSNEHSRHYHKEKRKQLIKNNNFDRNKKKBasic
NLS Segment(s)
PositionSequence
105-110EKRKQL
112-112K
118-122RNKKK
Subcellular Location(s) mito 22.5, mito_nucl 13.833, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MIKFSCKLRASCFYKVNNKKFCPFLLSYTSNYSTASNLKSQQQIRRIPSSVTAGTILKGLNFYKDGADPIALPDDEYPNWLWEILDKEKDEQLRSNEHSRHYHKEKRKQLIKNNNFDRNKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.73
3 0.76
4 0.76
5 0.74
6 0.71
7 0.67
8 0.61
9 0.56
10 0.48
11 0.43
12 0.41
13 0.39
14 0.37
15 0.39
16 0.39
17 0.33
18 0.32
19 0.27
20 0.22
21 0.22
22 0.21
23 0.19
24 0.19
25 0.23
26 0.28
27 0.33
28 0.37
29 0.42
30 0.47
31 0.48
32 0.51
33 0.48
34 0.42
35 0.4
36 0.38
37 0.3
38 0.24
39 0.21
40 0.16
41 0.15
42 0.15
43 0.12
44 0.08
45 0.09
46 0.08
47 0.08
48 0.08
49 0.08
50 0.08
51 0.09
52 0.09
53 0.08
54 0.09
55 0.07
56 0.07
57 0.09
58 0.08
59 0.08
60 0.08
61 0.1
62 0.09
63 0.11
64 0.11
65 0.1
66 0.1
67 0.1
68 0.09
69 0.09
70 0.14
71 0.16
72 0.2
73 0.2
74 0.21
75 0.25
76 0.28
77 0.28
78 0.28
79 0.28
80 0.31
81 0.35
82 0.42
83 0.42
84 0.45
85 0.51
86 0.52
87 0.59
88 0.6
89 0.66
90 0.68
91 0.75
92 0.8
93 0.82
94 0.86
95 0.85
96 0.87
97 0.89
98 0.88
99 0.89
100 0.88
101 0.88
102 0.86