Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6R1M4

Protein Details
Accession A0A2Z6R1M4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
78-98TMLLLCKTKKEKSRLKKSFKLHydrophilic
NLS Segment(s)
PositionSequence
86-95KKEKSRLKKS
Subcellular Location(s) cyto 17, pero 4, nucl 3, mito 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLNDNEWKLMKQLTKILQPFYDATKLLGGKKYATASFMYYVVATLQIKVIPKEVEVVDLTNDDDDLMMMLNLKMMMMTMLLLCKTKKEKSRLKKSFKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.44
4 0.39
5 0.39
6 0.37
7 0.33
8 0.31
9 0.23
10 0.21
11 0.22
12 0.23
13 0.23
14 0.25
15 0.22
16 0.2
17 0.22
18 0.24
19 0.2
20 0.2
21 0.18
22 0.16
23 0.16
24 0.15
25 0.13
26 0.1
27 0.1
28 0.08
29 0.09
30 0.08
31 0.06
32 0.07
33 0.08
34 0.09
35 0.09
36 0.11
37 0.09
38 0.09
39 0.11
40 0.1
41 0.11
42 0.1
43 0.1
44 0.09
45 0.09
46 0.09
47 0.07
48 0.07
49 0.05
50 0.05
51 0.04
52 0.04
53 0.03
54 0.03
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.03
64 0.04
65 0.04
66 0.05
67 0.06
68 0.09
69 0.09
70 0.15
71 0.21
72 0.29
73 0.37
74 0.46
75 0.56
76 0.65
77 0.77
78 0.82