Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6S3L8

Protein Details
Accession A0A2Z6S3L8    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
42-68TQANTNPKGKPKKHKKGKSGSAKSCSRHydrophilic
NLS Segment(s)
PositionSequence
48-61PKGKPKKHKKGKSG
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MVVDFLISYYGTNDTVGTVISSKVVMQPKIIMEIQEDQLSVTQANTNPKGKPKKHKKGKSGSAKSCSRCLLIMNEFLSEEIPYSDIPHNVPLTINVCKELRPKISNDLPKLLADLITKCLDVEIENKELYYLLWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.07
6 0.07
7 0.07
8 0.07
9 0.07
10 0.13
11 0.18
12 0.18
13 0.18
14 0.21
15 0.21
16 0.25
17 0.25
18 0.2
19 0.17
20 0.2
21 0.2
22 0.18
23 0.17
24 0.13
25 0.13
26 0.14
27 0.11
28 0.08
29 0.09
30 0.11
31 0.17
32 0.21
33 0.23
34 0.25
35 0.33
36 0.43
37 0.47
38 0.56
39 0.61
40 0.69
41 0.77
42 0.84
43 0.86
44 0.86
45 0.89
46 0.9
47 0.88
48 0.84
49 0.81
50 0.77
51 0.69
52 0.62
53 0.53
54 0.42
55 0.33
56 0.27
57 0.23
58 0.19
59 0.2
60 0.17
61 0.16
62 0.15
63 0.15
64 0.14
65 0.1
66 0.08
67 0.05
68 0.05
69 0.05
70 0.08
71 0.1
72 0.1
73 0.11
74 0.14
75 0.14
76 0.13
77 0.14
78 0.13
79 0.15
80 0.17
81 0.17
82 0.16
83 0.16
84 0.18
85 0.22
86 0.26
87 0.3
88 0.3
89 0.32
90 0.38
91 0.47
92 0.52
93 0.52
94 0.51
95 0.46
96 0.43
97 0.42
98 0.34
99 0.27
100 0.21
101 0.19
102 0.18
103 0.18
104 0.17
105 0.16
106 0.15
107 0.13
108 0.13
109 0.15
110 0.16
111 0.18
112 0.18
113 0.18
114 0.18
115 0.18