Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6R817

Protein Details
Accession A0A2Z6R817    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
82-105LNKSAAPKPLKKKNIISHKMYNKSHydrophilic
NLS Segment(s)
PositionSequence
90-93PLKK
Subcellular Location(s) nucl 15, mito_nucl 14.166, mito 11, cyto_nucl 9.166
Family & Domain DBs
Amino Acid Sequences MWKQTKLAWCKHSISSFRSLRRQPKTTVSGPNSSSFKKADSPPLPGDYWIKPHTSWKSSRRSTSSNTNKRSCKSGNRQSGNLNKSAAPKPLKKKNIISHKMYNKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.55
4 0.56
5 0.6
6 0.62
7 0.65
8 0.69
9 0.69
10 0.64
11 0.65
12 0.65
13 0.62
14 0.64
15 0.59
16 0.55
17 0.52
18 0.53
19 0.48
20 0.42
21 0.39
22 0.3
23 0.27
24 0.26
25 0.27
26 0.31
27 0.3
28 0.34
29 0.34
30 0.37
31 0.35
32 0.31
33 0.32
34 0.23
35 0.26
36 0.21
37 0.2
38 0.17
39 0.23
40 0.27
41 0.28
42 0.34
43 0.37
44 0.45
45 0.49
46 0.54
47 0.53
48 0.52
49 0.52
50 0.56
51 0.6
52 0.6
53 0.62
54 0.65
55 0.64
56 0.62
57 0.64
58 0.59
59 0.58
60 0.59
61 0.62
62 0.65
63 0.65
64 0.67
65 0.68
66 0.72
67 0.64
68 0.57
69 0.48
70 0.4
71 0.41
72 0.41
73 0.41
74 0.39
75 0.45
76 0.52
77 0.6
78 0.66
79 0.68
80 0.74
81 0.77
82 0.81
83 0.8
84 0.78
85 0.78