Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6R2T5

Protein Details
Accession A0A2Z6R2T5    Localization Confidence High Confidence Score 21.3
NoLS Segment(s)
PositionSequenceProtein Nature
60-79QYNTLKKRVKKLERDVHSFKHydrophilic
130-158EVKEKKAVFYRQRRRARLKKVKRVALRVKBasic
235-267CEAPIYSEKKKIRKLKCVKKRIGNKKVRLISGQHydrophilic
NLS Segment(s)
PositionSequence
139-153YRQRRRARLKKVKRV
243-262KKKIRKLKCVKKRIGNKKVR
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MKMVTDQNHSSDISSEQEVIRRTEKIAQLFELDKQNAKVYSALSGENRALKKQLKDYHSQYNTLKKRVKKLERDVHSFKVELEDLDESVDRETVVDLIYKIVLILINEKSKGSAYLSESSEDSDSVEIIEVKEKKAVFYRQRRRARLKKVKRVALRVKYLTALTNIPPKFTSSESSSSESSSSESSLSSESSSSESSSSESSLSSGSSSSESSLSSKTNSSESSLSNSDYDYMTCEAPIYSEKKKIRKLKCVKKRIGNKKVRLISGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.18
4 0.22
5 0.23
6 0.25
7 0.26
8 0.24
9 0.25
10 0.31
11 0.35
12 0.36
13 0.37
14 0.34
15 0.35
16 0.35
17 0.37
18 0.37
19 0.34
20 0.31
21 0.3
22 0.32
23 0.29
24 0.29
25 0.26
26 0.19
27 0.21
28 0.2
29 0.21
30 0.18
31 0.2
32 0.21
33 0.26
34 0.27
35 0.24
36 0.29
37 0.31
38 0.35
39 0.41
40 0.47
41 0.46
42 0.53
43 0.56
44 0.62
45 0.59
46 0.59
47 0.54
48 0.57
49 0.58
50 0.59
51 0.6
52 0.55
53 0.62
54 0.68
55 0.73
56 0.73
57 0.78
58 0.79
59 0.8
60 0.83
61 0.78
62 0.73
63 0.65
64 0.55
65 0.44
66 0.38
67 0.3
68 0.22
69 0.18
70 0.14
71 0.12
72 0.12
73 0.12
74 0.09
75 0.09
76 0.09
77 0.06
78 0.06
79 0.06
80 0.05
81 0.05
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.05
88 0.05
89 0.05
90 0.05
91 0.08
92 0.1
93 0.12
94 0.12
95 0.12
96 0.12
97 0.12
98 0.13
99 0.11
100 0.12
101 0.14
102 0.18
103 0.18
104 0.19
105 0.19
106 0.19
107 0.18
108 0.14
109 0.11
110 0.07
111 0.06
112 0.05
113 0.05
114 0.05
115 0.05
116 0.09
117 0.1
118 0.1
119 0.13
120 0.13
121 0.13
122 0.18
123 0.26
124 0.3
125 0.41
126 0.51
127 0.59
128 0.68
129 0.75
130 0.8
131 0.82
132 0.84
133 0.84
134 0.85
135 0.85
136 0.85
137 0.85
138 0.81
139 0.81
140 0.8
141 0.76
142 0.72
143 0.63
144 0.55
145 0.48
146 0.43
147 0.34
148 0.26
149 0.2
150 0.15
151 0.21
152 0.2
153 0.2
154 0.2
155 0.2
156 0.2
157 0.2
158 0.22
159 0.18
160 0.23
161 0.25
162 0.28
163 0.27
164 0.26
165 0.25
166 0.21
167 0.18
168 0.14
169 0.12
170 0.09
171 0.08
172 0.09
173 0.09
174 0.09
175 0.09
176 0.08
177 0.08
178 0.1
179 0.11
180 0.1
181 0.1
182 0.1
183 0.1
184 0.11
185 0.11
186 0.09
187 0.08
188 0.08
189 0.08
190 0.08
191 0.07
192 0.07
193 0.07
194 0.08
195 0.09
196 0.09
197 0.09
198 0.1
199 0.12
200 0.13
201 0.14
202 0.14
203 0.16
204 0.16
205 0.19
206 0.19
207 0.21
208 0.21
209 0.21
210 0.25
211 0.25
212 0.25
213 0.23
214 0.22
215 0.2
216 0.18
217 0.17
218 0.14
219 0.14
220 0.13
221 0.12
222 0.12
223 0.11
224 0.12
225 0.16
226 0.19
227 0.21
228 0.3
229 0.38
230 0.46
231 0.56
232 0.64
233 0.69
234 0.75
235 0.82
236 0.84
237 0.88
238 0.9
239 0.91
240 0.91
241 0.92
242 0.93
243 0.93
244 0.92
245 0.9
246 0.9
247 0.88