Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6S1F3

Protein Details
Accession A0A2Z6S1F3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
8-28FKNTLKTKVKRTLYRNFRNIKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MTLTGNEFKNTLKTKVKRTLYRNFRNIKHLLNRKFFEKVDRRFGHSKEEELEFFTHLANITGFESGIIEVIYKSREEVASDLYYTDIICLGKNTDRLRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.61
3 0.69
4 0.69
5 0.73
6 0.76
7 0.77
8 0.81
9 0.81
10 0.79
11 0.73
12 0.72
13 0.67
14 0.64
15 0.63
16 0.63
17 0.62
18 0.62
19 0.6
20 0.56
21 0.57
22 0.5
23 0.5
24 0.49
25 0.47
26 0.49
27 0.49
28 0.52
29 0.53
30 0.53
31 0.52
32 0.44
33 0.4
34 0.32
35 0.32
36 0.26
37 0.23
38 0.22
39 0.14
40 0.13
41 0.11
42 0.09
43 0.08
44 0.08
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.05
51 0.06
52 0.05
53 0.05
54 0.04
55 0.04
56 0.04
57 0.05
58 0.06
59 0.06
60 0.07
61 0.08
62 0.09
63 0.1
64 0.12
65 0.16
66 0.16
67 0.17
68 0.16
69 0.15
70 0.14
71 0.13
72 0.12
73 0.09
74 0.08
75 0.08
76 0.09
77 0.12
78 0.16
79 0.24