Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6R4A4

Protein Details
Accession A0A2Z6R4A4    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
64-84ISSDNKKTQRTLPKQSKKKKAHydrophilic
NLS Segment(s)
PositionSequence
75-84LPKQSKKKKA
Subcellular Location(s) nucl 15, cyto 6, mito 5
Family & Domain DBs
Amino Acid Sequences MEKREVYFLHHLKSFNLPLTFSAYHYLKSALRVAWNIRSLINSLVWEFDTVDDNDNGFKTPPVISSDNKKTQRTLPKQSKKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.31
4 0.27
5 0.24
6 0.3
7 0.29
8 0.24
9 0.26
10 0.22
11 0.21
12 0.22
13 0.23
14 0.17
15 0.19
16 0.2
17 0.15
18 0.17
19 0.18
20 0.19
21 0.22
22 0.23
23 0.21
24 0.19
25 0.18
26 0.18
27 0.16
28 0.15
29 0.1
30 0.09
31 0.09
32 0.09
33 0.08
34 0.07
35 0.07
36 0.09
37 0.09
38 0.1
39 0.1
40 0.1
41 0.1
42 0.1
43 0.11
44 0.09
45 0.08
46 0.08
47 0.09
48 0.1
49 0.15
50 0.18
51 0.2
52 0.29
53 0.38
54 0.47
55 0.52
56 0.53
57 0.51
58 0.56
59 0.65
60 0.65
61 0.68
62 0.69
63 0.74
64 0.82