Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QZ62

Protein Details
Accession A0A2Z6QZ62    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
21-45HAELTPKGKGKKKNKNKNNPTVDLNHydrophilic
NLS Segment(s)
PositionSequence
27-37KGKGKKKNKNK
Subcellular Location(s) nucl 21, cyto_nucl 16, cyto 5
Family & Domain DBs
Amino Acid Sequences MDIDISSPAQHQSNPVTPLTHAELTPKGKGKKKNKNKNNPTVDLNFAGSWDKKPAQTASSSTQPLPRLRTLLTTWRYPSQHLYQICMT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.27
4 0.25
5 0.29
6 0.3
7 0.26
8 0.2
9 0.2
10 0.25
11 0.27
12 0.31
13 0.34
14 0.35
15 0.4
16 0.5
17 0.58
18 0.64
19 0.72
20 0.79
21 0.83
22 0.88
23 0.91
24 0.92
25 0.89
26 0.82
27 0.75
28 0.66
29 0.58
30 0.47
31 0.38
32 0.27
33 0.2
34 0.18
35 0.14
36 0.12
37 0.14
38 0.14
39 0.13
40 0.16
41 0.18
42 0.17
43 0.19
44 0.22
45 0.23
46 0.27
47 0.29
48 0.27
49 0.3
50 0.33
51 0.34
52 0.35
53 0.33
54 0.29
55 0.28
56 0.32
57 0.31
58 0.36
59 0.36
60 0.37
61 0.39
62 0.43
63 0.44
64 0.43
65 0.46
66 0.43
67 0.47
68 0.43