Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6SEJ6

Protein Details
Accession A0A2Z6SEJ6    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MDARRRRRRDGRNGRRNDRNRTRHVQBasic
NLS Segment(s)
PositionSequence
4-21RRRRRRDGRNGRRNDRNR
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MDARRRRRRDGRNGRRNDRNRTRHVQPINPINPTNPINLINPVDDNKKFLNLIEKLPYQITDNEDINGFFNGFHFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.88
4 0.88
5 0.87
6 0.85
7 0.82
8 0.79
9 0.75
10 0.73
11 0.71
12 0.66
13 0.62
14 0.63
15 0.58
16 0.54
17 0.49
18 0.41
19 0.39
20 0.34
21 0.29
22 0.2
23 0.19
24 0.16
25 0.18
26 0.18
27 0.14
28 0.14
29 0.14
30 0.17
31 0.15
32 0.17
33 0.16
34 0.17
35 0.16
36 0.16
37 0.22
38 0.2
39 0.23
40 0.26
41 0.26
42 0.26
43 0.27
44 0.27
45 0.21
46 0.22
47 0.22
48 0.22
49 0.22
50 0.21
51 0.21
52 0.21
53 0.2
54 0.18
55 0.14
56 0.1