Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6R7U9

Protein Details
Accession A0A2Z6R7U9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
57-79LMSACCVCRRKRGKNNENDNDSVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, E.R. 6, mito 2, extr 1, golg 1, vacu 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQLFIVFLFLLNLIVTNAFPIEENSISSNLLRKRNILNNEYVLATFKWGIIFVVVFLMSACCVCRRKRGKNNENDNDSVNSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.05
6 0.06
7 0.06
8 0.09
9 0.09
10 0.11
11 0.12
12 0.12
13 0.13
14 0.13
15 0.18
16 0.2
17 0.25
18 0.24
19 0.25
20 0.3
21 0.37
22 0.42
23 0.39
24 0.36
25 0.32
26 0.33
27 0.3
28 0.25
29 0.19
30 0.13
31 0.12
32 0.09
33 0.08
34 0.07
35 0.06
36 0.06
37 0.05
38 0.05
39 0.04
40 0.05
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.05
47 0.05
48 0.09
49 0.14
50 0.16
51 0.27
52 0.36
53 0.48
54 0.58
55 0.69
56 0.75
57 0.81
58 0.91
59 0.9
60 0.87
61 0.78
62 0.72