Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QRK5

Protein Details
Accession A0A2Z6QRK5    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
77-105LDHYQKKTLIKQDKRRRRYDKKAKALTMSHydrophilic
NLS Segment(s)
PositionSequence
88-100QDKRRRRYDKKAK
Subcellular Location(s) nucl 20, mito_nucl 13.833, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MASSLPLLPRPGKEDKLSYLKAIHKKWFNNTITTVTSHRRGTEYQTKYLHLDCASFNGVSRRHIFCKKYFNPSLVSLDHYQKKTLIKQDKRRRRYDKKAKALTMSVYHSRKFPGHNTIKQAAKVSHHLSPHNRTFYKVIKHLPLSSLSRIPEALPYIPIREQISTRDKHLNPPIKKPQIPNQNDLTNFNPIPDDLLAEDRKDQLAKLLPFIPRVQIFNNSRTIEFPPGSSRWWEYVNQGKKAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.51
4 0.51
5 0.48
6 0.47
7 0.51
8 0.55
9 0.55
10 0.57
11 0.56
12 0.6
13 0.65
14 0.68
15 0.62
16 0.59
17 0.56
18 0.52
19 0.46
20 0.44
21 0.4
22 0.35
23 0.38
24 0.34
25 0.33
26 0.32
27 0.31
28 0.37
29 0.43
30 0.43
31 0.45
32 0.45
33 0.46
34 0.45
35 0.45
36 0.4
37 0.3
38 0.27
39 0.2
40 0.21
41 0.21
42 0.18
43 0.18
44 0.2
45 0.2
46 0.22
47 0.27
48 0.28
49 0.32
50 0.39
51 0.42
52 0.43
53 0.52
54 0.54
55 0.59
56 0.57
57 0.53
58 0.5
59 0.49
60 0.47
61 0.37
62 0.35
63 0.29
64 0.33
65 0.37
66 0.34
67 0.31
68 0.3
69 0.33
70 0.35
71 0.41
72 0.45
73 0.49
74 0.59
75 0.69
76 0.76
77 0.81
78 0.86
79 0.87
80 0.87
81 0.89
82 0.89
83 0.89
84 0.89
85 0.89
86 0.81
87 0.73
88 0.65
89 0.55
90 0.47
91 0.4
92 0.37
93 0.3
94 0.28
95 0.26
96 0.26
97 0.26
98 0.25
99 0.25
100 0.28
101 0.34
102 0.37
103 0.42
104 0.45
105 0.45
106 0.43
107 0.42
108 0.33
109 0.27
110 0.28
111 0.25
112 0.23
113 0.23
114 0.26
115 0.29
116 0.34
117 0.37
118 0.4
119 0.37
120 0.36
121 0.37
122 0.39
123 0.4
124 0.38
125 0.36
126 0.34
127 0.36
128 0.35
129 0.32
130 0.31
131 0.29
132 0.26
133 0.26
134 0.22
135 0.21
136 0.2
137 0.19
138 0.17
139 0.15
140 0.13
141 0.12
142 0.13
143 0.14
144 0.14
145 0.17
146 0.16
147 0.15
148 0.16
149 0.2
150 0.27
151 0.26
152 0.29
153 0.36
154 0.36
155 0.42
156 0.51
157 0.54
158 0.51
159 0.59
160 0.66
161 0.65
162 0.69
163 0.66
164 0.66
165 0.67
166 0.68
167 0.63
168 0.59
169 0.56
170 0.53
171 0.52
172 0.45
173 0.4
174 0.36
175 0.31
176 0.25
177 0.2
178 0.21
179 0.17
180 0.15
181 0.1
182 0.16
183 0.16
184 0.17
185 0.18
186 0.17
187 0.19
188 0.18
189 0.17
190 0.17
191 0.24
192 0.24
193 0.26
194 0.3
195 0.3
196 0.32
197 0.33
198 0.34
199 0.28
200 0.3
201 0.29
202 0.34
203 0.36
204 0.37
205 0.44
206 0.4
207 0.39
208 0.38
209 0.4
210 0.37
211 0.34
212 0.32
213 0.3
214 0.3
215 0.31
216 0.33
217 0.32
218 0.29
219 0.31
220 0.31
221 0.32
222 0.41
223 0.47