Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RCD4

Protein Details
Accession A0A2Z6RCD4    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MKDEDKKQKWDKRTKRMKVNEKEGKEQKBasic
NLS Segment(s)
PositionSequence
6-52KKQKWDKRTKRMKVNEKEGKEQKNNGRIKRNERTMGESKGTKEKIMR
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
Amino Acid Sequences MKDEDKKQKWDKRTKRMKVNEKEGKEQKNNGRIKRNERTMGESKGTKEKIMRESKGTKETIMGESKGAKETIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.91
4 0.92
5 0.9
6 0.9
7 0.89
8 0.82
9 0.82
10 0.79
11 0.76
12 0.7
13 0.68
14 0.64
15 0.64
16 0.66
17 0.63
18 0.65
19 0.63
20 0.67
21 0.67
22 0.67
23 0.63
24 0.57
25 0.58
26 0.53
27 0.51
28 0.45
29 0.39
30 0.35
31 0.37
32 0.36
33 0.31
34 0.29
35 0.31
36 0.37
37 0.44
38 0.44
39 0.43
40 0.49
41 0.53
42 0.56
43 0.51
44 0.43
45 0.37
46 0.38
47 0.36
48 0.34
49 0.29
50 0.24
51 0.27
52 0.28
53 0.27