Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QCS5

Protein Details
Accession A0A2Z6QCS5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MGRVGRSRTHKGNRDQYRKYRTRNYAKDLDHydrophilic
79-102LNEHQRSKNHKKRIKLLKETPYTQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGRVGRSRTHKGNRDQYRKYRTRNYAKDLDQIHEDVTKVTENGGDETILKLQEWNEDLPGLGQYYCIPCARYFINSEALNEHQRSKNHKKRIKLLKETPYTQAEAEAAVGYSTENSRGKNNQPNIGFYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.86
4 0.86
5 0.86
6 0.85
7 0.84
8 0.84
9 0.85
10 0.84
11 0.81
12 0.79
13 0.74
14 0.72
15 0.64
16 0.56
17 0.47
18 0.39
19 0.33
20 0.25
21 0.22
22 0.16
23 0.14
24 0.13
25 0.1
26 0.09
27 0.1
28 0.09
29 0.1
30 0.1
31 0.09
32 0.09
33 0.1
34 0.11
35 0.09
36 0.08
37 0.08
38 0.08
39 0.1
40 0.11
41 0.11
42 0.1
43 0.1
44 0.1
45 0.09
46 0.09
47 0.07
48 0.05
49 0.05
50 0.05
51 0.06
52 0.08
53 0.08
54 0.09
55 0.08
56 0.11
57 0.11
58 0.12
59 0.14
60 0.14
61 0.2
62 0.19
63 0.2
64 0.2
65 0.22
66 0.24
67 0.23
68 0.25
69 0.23
70 0.26
71 0.35
72 0.44
73 0.51
74 0.58
75 0.63
76 0.66
77 0.72
78 0.8
79 0.81
80 0.8
81 0.8
82 0.79
83 0.81
84 0.76
85 0.71
86 0.62
87 0.53
88 0.43
89 0.35
90 0.25
91 0.18
92 0.16
93 0.11
94 0.08
95 0.06
96 0.06
97 0.05
98 0.06
99 0.07
100 0.12
101 0.14
102 0.16
103 0.21
104 0.28
105 0.36
106 0.45
107 0.5
108 0.53
109 0.53