Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A1C841

Protein Details
Accession A1C841    Localization Confidence High Confidence Score 20.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAPGRTIKRRRLSPPDDEDNSHydrophilic
44-70EQDYERQPRKLSKKRKENNRLPIKTAEHydrophilic
353-383DNTLRGKKMKQKREFRTKRERKLQKERNAVEBasic
NLS Segment(s)
PositionSequence
52-60RKLSKKRKE
357-379RGKKMKQKREFRTKRERKLQKER
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016024  ARM-type_fold  
IPR005612  CCAAT-binding_factor  
IPR011501  Noc3_N  
IPR016903  Nucleolar_cplx-assoc_3  
Gene Ontology GO:0030691  C:Noc2p-Noc3p complex  
GO:0005656  C:nuclear pre-replicative complex  
GO:0005730  C:nucleolus  
GO:0003682  F:chromatin binding  
GO:0006270  P:DNA replication initiation  
GO:0006267  P:pre-replicative complex assembly involved in nuclear cell cycle DNA replication  
GO:0000027  P:ribosomal large subunit assembly  
GO:0006364  P:rRNA processing  
KEGG act:ACLA_076020  -  
Pfam View protein in Pfam  
PF03914  CBF  
PF07540  NOC3p  
Amino Acid Sequences MAPGRTIKRRRLSPPDDEDNSSSRPARDSALNDFHNSAAEWDLEQDYERQPRKLSKKRKENNRLPIKTAEGFQAVEESEAEAEESDSFLGTDDDEDDDADDDEEMDDDEEAEEKPKIPLKLQIIQAKEELARLATYINEDPEEHISSFKTMADMVENGEHVAIKKLALASQAAVYKDVIPGYRIRPLSEEDMSAKISKDVRKLRAFEQSLLSGYKHYVQKLSDLTKSSKRGENTAVDPSLKSLAINCACNLLLSVPHFNFRGELLKILVNRLARRQIDVDFIKCRETMEEVFSRDEDGVVSLEAVRLLTKMMKAKDFRIHESVLNTFLHLRLLSEFSSKGSRDRIDREPEEEDNTLRGKKMKQKREFRTKRERKLQKERNAVEKDMRQADALVSHEERDKNQAESLKLVFATYFRILKLRIPNLMGPVLEGLAKYAHLINQDFFGDLLEALKDLIGHADKSEVGEDEEEEEANETETATRDAQREALLCTITAFALLEGQDVSKAAASLHLDLSFFVKHLYRSLYSISVNPEIEFNPTKSLRLPDPNSSEADGSMPSQNAKNKVNFQTPTVLLLRCLQFTLLSRAHGTPPPLRLASFTKRLLTSSLQVPEKSALATLSLLNQVAKHHVRRIAPLWHSEERRGDGVFNPFATDIETTNVFAGTVWEGELLRLHYCPQVRTVAADIEKMVATQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.76
4 0.72
5 0.66
6 0.59
7 0.54
8 0.49
9 0.43
10 0.34
11 0.32
12 0.29
13 0.29
14 0.31
15 0.33
16 0.37
17 0.43
18 0.43
19 0.43
20 0.43
21 0.39
22 0.34
23 0.3
24 0.23
25 0.16
26 0.14
27 0.12
28 0.13
29 0.14
30 0.13
31 0.14
32 0.15
33 0.19
34 0.28
35 0.32
36 0.32
37 0.37
38 0.46
39 0.56
40 0.64
41 0.7
42 0.71
43 0.78
44 0.86
45 0.92
46 0.93
47 0.93
48 0.93
49 0.93
50 0.88
51 0.81
52 0.76
53 0.71
54 0.62
55 0.53
56 0.46
57 0.37
58 0.32
59 0.27
60 0.24
61 0.18
62 0.16
63 0.14
64 0.11
65 0.09
66 0.09
67 0.09
68 0.07
69 0.07
70 0.07
71 0.07
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.07
80 0.08
81 0.08
82 0.09
83 0.09
84 0.09
85 0.09
86 0.09
87 0.08
88 0.07
89 0.07
90 0.07
91 0.06
92 0.06
93 0.05
94 0.05
95 0.06
96 0.06
97 0.07
98 0.08
99 0.09
100 0.09
101 0.13
102 0.18
103 0.19
104 0.2
105 0.27
106 0.32
107 0.38
108 0.45
109 0.47
110 0.44
111 0.45
112 0.44
113 0.39
114 0.33
115 0.27
116 0.2
117 0.15
118 0.12
119 0.1
120 0.1
121 0.09
122 0.12
123 0.12
124 0.13
125 0.13
126 0.14
127 0.16
128 0.19
129 0.21
130 0.18
131 0.17
132 0.17
133 0.17
134 0.17
135 0.15
136 0.12
137 0.09
138 0.1
139 0.11
140 0.1
141 0.11
142 0.11
143 0.11
144 0.11
145 0.11
146 0.1
147 0.09
148 0.11
149 0.1
150 0.09
151 0.1
152 0.11
153 0.12
154 0.13
155 0.13
156 0.11
157 0.14
158 0.17
159 0.15
160 0.16
161 0.15
162 0.15
163 0.15
164 0.16
165 0.13
166 0.11
167 0.14
168 0.16
169 0.22
170 0.22
171 0.22
172 0.23
173 0.26
174 0.29
175 0.27
176 0.26
177 0.22
178 0.23
179 0.23
180 0.22
181 0.19
182 0.17
183 0.21
184 0.23
185 0.3
186 0.36
187 0.42
188 0.48
189 0.5
190 0.51
191 0.56
192 0.55
193 0.49
194 0.44
195 0.37
196 0.33
197 0.31
198 0.28
199 0.18
200 0.17
201 0.2
202 0.2
203 0.19
204 0.21
205 0.2
206 0.24
207 0.29
208 0.32
209 0.29
210 0.3
211 0.33
212 0.37
213 0.42
214 0.41
215 0.41
216 0.38
217 0.38
218 0.4
219 0.4
220 0.36
221 0.36
222 0.34
223 0.29
224 0.28
225 0.25
226 0.22
227 0.17
228 0.14
229 0.1
230 0.16
231 0.17
232 0.18
233 0.17
234 0.17
235 0.17
236 0.17
237 0.16
238 0.09
239 0.09
240 0.1
241 0.14
242 0.12
243 0.14
244 0.15
245 0.15
246 0.15
247 0.14
248 0.17
249 0.13
250 0.14
251 0.13
252 0.15
253 0.16
254 0.16
255 0.18
256 0.16
257 0.17
258 0.2
259 0.25
260 0.23
261 0.25
262 0.26
263 0.24
264 0.28
265 0.29
266 0.28
267 0.25
268 0.25
269 0.25
270 0.23
271 0.22
272 0.16
273 0.18
274 0.16
275 0.17
276 0.19
277 0.19
278 0.2
279 0.2
280 0.19
281 0.16
282 0.14
283 0.1
284 0.08
285 0.06
286 0.05
287 0.05
288 0.05
289 0.05
290 0.05
291 0.05
292 0.04
293 0.04
294 0.04
295 0.05
296 0.08
297 0.12
298 0.14
299 0.19
300 0.2
301 0.24
302 0.31
303 0.33
304 0.35
305 0.34
306 0.34
307 0.3
308 0.3
309 0.27
310 0.23
311 0.19
312 0.16
313 0.13
314 0.11
315 0.1
316 0.08
317 0.08
318 0.07
319 0.08
320 0.08
321 0.09
322 0.09
323 0.1
324 0.13
325 0.13
326 0.14
327 0.16
328 0.17
329 0.19
330 0.24
331 0.29
332 0.33
333 0.34
334 0.35
335 0.35
336 0.34
337 0.34
338 0.29
339 0.24
340 0.18
341 0.19
342 0.16
343 0.14
344 0.15
345 0.17
346 0.25
347 0.35
348 0.43
349 0.51
350 0.61
351 0.7
352 0.79
353 0.85
354 0.84
355 0.87
356 0.86
357 0.86
358 0.87
359 0.86
360 0.85
361 0.87
362 0.88
363 0.85
364 0.86
365 0.79
366 0.78
367 0.72
368 0.64
369 0.57
370 0.5
371 0.45
372 0.37
373 0.34
374 0.24
375 0.21
376 0.19
377 0.17
378 0.15
379 0.13
380 0.11
381 0.11
382 0.14
383 0.15
384 0.15
385 0.18
386 0.19
387 0.17
388 0.2
389 0.23
390 0.2
391 0.22
392 0.22
393 0.18
394 0.16
395 0.15
396 0.12
397 0.09
398 0.12
399 0.11
400 0.12
401 0.11
402 0.13
403 0.13
404 0.18
405 0.25
406 0.24
407 0.25
408 0.26
409 0.27
410 0.28
411 0.28
412 0.23
413 0.16
414 0.14
415 0.11
416 0.09
417 0.08
418 0.06
419 0.05
420 0.05
421 0.06
422 0.06
423 0.07
424 0.09
425 0.1
426 0.1
427 0.12
428 0.12
429 0.11
430 0.11
431 0.09
432 0.07
433 0.06
434 0.06
435 0.05
436 0.05
437 0.04
438 0.04
439 0.04
440 0.04
441 0.06
442 0.06
443 0.07
444 0.07
445 0.08
446 0.08
447 0.09
448 0.09
449 0.08
450 0.08
451 0.08
452 0.08
453 0.09
454 0.09
455 0.09
456 0.08
457 0.08
458 0.08
459 0.08
460 0.07
461 0.06
462 0.06
463 0.07
464 0.09
465 0.09
466 0.12
467 0.13
468 0.14
469 0.15
470 0.16
471 0.16
472 0.16
473 0.16
474 0.14
475 0.12
476 0.12
477 0.11
478 0.09
479 0.08
480 0.07
481 0.05
482 0.06
483 0.06
484 0.06
485 0.06
486 0.06
487 0.06
488 0.06
489 0.06
490 0.05
491 0.05
492 0.05
493 0.08
494 0.09
495 0.1
496 0.12
497 0.12
498 0.12
499 0.12
500 0.14
501 0.11
502 0.1
503 0.1
504 0.1
505 0.1
506 0.13
507 0.17
508 0.16
509 0.18
510 0.2
511 0.22
512 0.21
513 0.23
514 0.25
515 0.25
516 0.24
517 0.22
518 0.21
519 0.19
520 0.23
521 0.23
522 0.2
523 0.23
524 0.23
525 0.23
526 0.25
527 0.28
528 0.29
529 0.36
530 0.39
531 0.41
532 0.46
533 0.47
534 0.46
535 0.44
536 0.39
537 0.29
538 0.26
539 0.19
540 0.15
541 0.15
542 0.13
543 0.14
544 0.18
545 0.22
546 0.27
547 0.32
548 0.36
549 0.41
550 0.47
551 0.54
552 0.51
553 0.48
554 0.49
555 0.45
556 0.44
557 0.39
558 0.32
559 0.25
560 0.29
561 0.28
562 0.22
563 0.22
564 0.18
565 0.17
566 0.19
567 0.25
568 0.22
569 0.22
570 0.24
571 0.25
572 0.29
573 0.3
574 0.32
575 0.29
576 0.31
577 0.34
578 0.32
579 0.31
580 0.31
581 0.35
582 0.38
583 0.41
584 0.4
585 0.39
586 0.39
587 0.4
588 0.4
589 0.36
590 0.33
591 0.33
592 0.37
593 0.36
594 0.35
595 0.36
596 0.34
597 0.31
598 0.27
599 0.21
600 0.14
601 0.12
602 0.13
603 0.11
604 0.12
605 0.13
606 0.13
607 0.13
608 0.14
609 0.14
610 0.21
611 0.27
612 0.29
613 0.34
614 0.39
615 0.41
616 0.46
617 0.51
618 0.52
619 0.49
620 0.52
621 0.53
622 0.55
623 0.56
624 0.56
625 0.55
626 0.5
627 0.49
628 0.43
629 0.37
630 0.34
631 0.37
632 0.34
633 0.29
634 0.27
635 0.25
636 0.24
637 0.24
638 0.2
639 0.14
640 0.15
641 0.16
642 0.14
643 0.15
644 0.15
645 0.12
646 0.11
647 0.12
648 0.1
649 0.09
650 0.09
651 0.1
652 0.1
653 0.1
654 0.13
655 0.13
656 0.13
657 0.14
658 0.15
659 0.2
660 0.23
661 0.24
662 0.26
663 0.3
664 0.29
665 0.31
666 0.32
667 0.34
668 0.32
669 0.32
670 0.28
671 0.25
672 0.24