Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6SCF7

Protein Details
Accession A0A2Z6SCF7    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
201-230RSSRNDREYKPYDRRDRGRDRDRPGRRTSYBasic
NLS Segment(s)
PositionSequence
219-219R
Subcellular Location(s) nucl 18, cyto_nucl 14, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Amino Acid Sequences MSRAKDGKQADVSGKDSAPADTELEVQADSLFTKIRNTLSELEGGFNDVDSLLEPLLSLPLSELASSLGPIDRARLYLLYGYTLNSLISLFLELKGQDSKIKILEEQYRRIQDCSEKITNTVNPPQPSLSLNRDAASRFVKHALSNVKDRDRDRDTRENGRATSSGTHIKFNDDENFGGSSNNRTNNRFMRDDKDRDYRSRSSRNDREYKPYDRRDRGRDRDRPGRRTSYAKTLFVLFVGEVFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.32
3 0.28
4 0.24
5 0.21
6 0.18
7 0.16
8 0.14
9 0.15
10 0.14
11 0.14
12 0.13
13 0.11
14 0.1
15 0.09
16 0.08
17 0.07
18 0.08
19 0.08
20 0.1
21 0.13
22 0.15
23 0.17
24 0.21
25 0.23
26 0.23
27 0.27
28 0.25
29 0.24
30 0.21
31 0.21
32 0.17
33 0.13
34 0.11
35 0.07
36 0.07
37 0.06
38 0.07
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.06
45 0.05
46 0.04
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.08
54 0.08
55 0.06
56 0.07
57 0.07
58 0.09
59 0.09
60 0.09
61 0.1
62 0.1
63 0.1
64 0.11
65 0.12
66 0.11
67 0.11
68 0.11
69 0.11
70 0.11
71 0.1
72 0.08
73 0.07
74 0.06
75 0.05
76 0.06
77 0.05
78 0.05
79 0.07
80 0.06
81 0.08
82 0.09
83 0.1
84 0.11
85 0.12
86 0.13
87 0.14
88 0.15
89 0.14
90 0.18
91 0.25
92 0.27
93 0.31
94 0.34
95 0.37
96 0.37
97 0.37
98 0.34
99 0.3
100 0.29
101 0.31
102 0.29
103 0.24
104 0.25
105 0.27
106 0.27
107 0.26
108 0.29
109 0.27
110 0.25
111 0.26
112 0.25
113 0.23
114 0.23
115 0.23
116 0.21
117 0.2
118 0.2
119 0.2
120 0.2
121 0.2
122 0.21
123 0.2
124 0.17
125 0.15
126 0.16
127 0.17
128 0.16
129 0.2
130 0.24
131 0.24
132 0.29
133 0.33
134 0.35
135 0.39
136 0.4
137 0.43
138 0.42
139 0.46
140 0.47
141 0.52
142 0.52
143 0.57
144 0.61
145 0.57
146 0.51
147 0.48
148 0.41
149 0.33
150 0.29
151 0.24
152 0.26
153 0.23
154 0.26
155 0.24
156 0.27
157 0.26
158 0.27
159 0.28
160 0.23
161 0.22
162 0.2
163 0.21
164 0.18
165 0.18
166 0.16
167 0.17
168 0.19
169 0.26
170 0.28
171 0.29
172 0.36
173 0.42
174 0.47
175 0.47
176 0.46
177 0.46
178 0.52
179 0.56
180 0.56
181 0.59
182 0.58
183 0.58
184 0.62
185 0.62
186 0.62
187 0.65
188 0.67
189 0.68
190 0.72
191 0.77
192 0.8
193 0.76
194 0.77
195 0.74
196 0.75
197 0.74
198 0.75
199 0.76
200 0.76
201 0.81
202 0.81
203 0.85
204 0.86
205 0.87
206 0.86
207 0.84
208 0.85
209 0.86
210 0.84
211 0.81
212 0.79
213 0.74
214 0.73
215 0.69
216 0.69
217 0.67
218 0.61
219 0.55
220 0.49
221 0.44
222 0.36
223 0.32
224 0.21