Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6Q2Z9

Protein Details
Accession A0A2Z6Q2Z9    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-44IRSQEARRREVRRQEARRREVRRKEIRRRIRSHRPINNEBasic
NLS Segment(s)
PositionSequence
10-39EARRREVRRQEARRREVRRKEIRRRIRSHR
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MVRREIRSQEARRREVRRQEARRREVRRKEIRRRIRSHRPINNEDTLRRIANLSQQDTTDLFTAQFFNGSSFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.76
3 0.78
4 0.79
5 0.8
6 0.84
7 0.86
8 0.88
9 0.88
10 0.86
11 0.86
12 0.85
13 0.85
14 0.85
15 0.85
16 0.88
17 0.89
18 0.91
19 0.9
20 0.87
21 0.86
22 0.86
23 0.86
24 0.85
25 0.82
26 0.79
27 0.74
28 0.72
29 0.69
30 0.61
31 0.51
32 0.45
33 0.4
34 0.32
35 0.27
36 0.23
37 0.17
38 0.22
39 0.27
40 0.26
41 0.25
42 0.25
43 0.27
44 0.26
45 0.27
46 0.21
47 0.15
48 0.12
49 0.12
50 0.13
51 0.11
52 0.12
53 0.1