Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6R9I8

Protein Details
Accession A0A2Z6R9I8    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
134-153DCDWRKKKIIELQRSKRSLNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019190  EXOV  
Gene Ontology GO:0045145  F:single-stranded DNA 5'-3' DNA exonuclease activity  
Pfam View protein in Pfam  
PF09810  Exo5  
Amino Acid Sequences MLYKKLFDELAEGKFDDVMMFKTLDLNPILEFSKELTDFIKLNLKEIREFNLKSLMNIVIDRFRKVGKSYDILEVHYILQENRSNLNFKYTNYDENKLTKYLYNTTTYWKGNRNPEDVPIEEAWKCQICEFADDCDWRKKKIIELQRSKRSLNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.15
4 0.11
5 0.11
6 0.1
7 0.1
8 0.1
9 0.14
10 0.15
11 0.17
12 0.16
13 0.15
14 0.14
15 0.15
16 0.16
17 0.12
18 0.12
19 0.11
20 0.15
21 0.14
22 0.14
23 0.13
24 0.15
25 0.15
26 0.16
27 0.23
28 0.18
29 0.22
30 0.24
31 0.25
32 0.26
33 0.27
34 0.3
35 0.29
36 0.29
37 0.27
38 0.33
39 0.31
40 0.28
41 0.29
42 0.24
43 0.18
44 0.18
45 0.18
46 0.16
47 0.17
48 0.18
49 0.16
50 0.16
51 0.17
52 0.18
53 0.22
54 0.19
55 0.21
56 0.22
57 0.28
58 0.28
59 0.27
60 0.26
61 0.21
62 0.18
63 0.16
64 0.14
65 0.07
66 0.1
67 0.11
68 0.11
69 0.13
70 0.14
71 0.15
72 0.15
73 0.21
74 0.2
75 0.18
76 0.25
77 0.24
78 0.31
79 0.33
80 0.36
81 0.32
82 0.34
83 0.36
84 0.29
85 0.29
86 0.23
87 0.23
88 0.24
89 0.25
90 0.25
91 0.24
92 0.28
93 0.32
94 0.32
95 0.33
96 0.35
97 0.39
98 0.44
99 0.49
100 0.48
101 0.43
102 0.46
103 0.47
104 0.41
105 0.39
106 0.31
107 0.29
108 0.25
109 0.24
110 0.23
111 0.21
112 0.2
113 0.16
114 0.2
115 0.18
116 0.23
117 0.24
118 0.24
119 0.27
120 0.3
121 0.33
122 0.39
123 0.4
124 0.38
125 0.43
126 0.41
127 0.45
128 0.52
129 0.58
130 0.59
131 0.69
132 0.76
133 0.8
134 0.82