FuNGI

A1CJI4

Protein Details

Accession

A1CJI4

Localization Confidence

Low

Confidence Score

8.7

NoLS Segment(s)

Position	Sequence	Protein Nature
83-116	FSDADRKEARKRRGASRRRRRKGAWKKLLWVKQS	Basic

NLS Segment(s)

Position	Sequence
88-109	RKEARKRRGASRRRRRKGAWKK

Subcellular Location(s)

plas 23, nucl 2, E.R. 2

Family & Domain DBs

InterPro	View protein in InterPro IPR009450 Plno_GlcNAc_GPI2
Gene Ontology	GO:0016020 C:membrane GO:0016740 F:transferase activity GO:0006506 P:GPI anchor biosynthetic process
KEGG	act:ACLA_035110 -
Pfam	View protein in Pfam PF06432 GPI2

Amino Acid Sequences

MPPPPDSPPPIPPPVPVETHPNRTSSLKPPSHLRTLPDPTRLAPEDAYLSSAHLRGRAATASYDDSLRALSSNAAGLRPPPAFSDADRKEARKRRGASRRRRRKGAWKKLLWVKQSYPDNYTDTETFLDHLQRNPRVRPYDFWPLVADSTVIVQHVCSVAIFVCCFVGIVKGRVSPVSVVCWGSVGTAVGWILWDSWVWREHHAETSRNAERATEGDDGSSSSSVSSSVHPSSSGPGPLSGPRPSPGQGHGQVHGLGLTMAPNESGELLRRRSTGFGGDTYGLADPGASLSQANGAPGGGGVHPGYLAQENDETAVFSSRNRQRLSTVKSAFLIYFSLLGLSPILKSLTKSTASDSIWAMSCWLLIMNIFSFDYGSGEGAGATKFPASLSTNAAVMASTVLASRLPSTTHVFSLMLFSIEVFGLFPIFRRQLRHFSWTGHVLLTLALVMVAGGAVGMTLRGGWTAAVVGSILGSILTAFAMGGCSWWLISLQKYKNVVTGPWDPARPIIRRQWD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.46
2	0.46
3	0.4
4	0.43
5	0.42
6	0.51
7	0.5
8	0.46
9	0.45
10	0.45
11	0.48
12	0.47
13	0.51
14	0.47
15	0.49
16	0.56
17	0.59
18	0.64
19	0.62
20	0.58
21	0.57
22	0.62
23	0.64
24	0.61
25	0.57
26	0.49
27	0.54
28	0.51
29	0.44
30	0.35
31	0.31
32	0.28
33	0.26
34	0.26
35	0.18
36	0.18
37	0.17
38	0.19
39	0.18
40	0.16
41	0.16
42	0.16
43	0.19
44	0.19
45	0.18
46	0.17
47	0.19
48	0.2
49	0.21
50	0.2
51	0.18
52	0.16
53	0.15
54	0.14
55	0.12
56	0.09
57	0.08
58	0.09
59	0.12
60	0.12
61	0.12
62	0.12
63	0.13
64	0.17
65	0.17
66	0.17
67	0.16
68	0.18
69	0.19
70	0.21
71	0.31
72	0.29
73	0.37
74	0.4
75	0.41
76	0.48
77	0.56
78	0.61
79	0.6
80	0.63
81	0.66
82	0.73
83	0.8
84	0.82
85	0.84
86	0.87
87	0.88
88	0.91
89	0.88
90	0.89
91	0.9
92	0.9
93	0.89
94	0.84
95	0.84
96	0.84
97	0.83
98	0.77
99	0.72
100	0.64
101	0.62
102	0.63
103	0.57
104	0.5
105	0.46
106	0.43
107	0.38
108	0.38
109	0.3
110	0.24
111	0.22
112	0.19
113	0.17
114	0.16
115	0.2
116	0.18
117	0.22
118	0.28
119	0.34
120	0.39
121	0.43
122	0.49
123	0.49
124	0.5
125	0.49
126	0.48
127	0.52
128	0.48
129	0.45
130	0.39
131	0.34
132	0.32
133	0.28
134	0.21
135	0.1
136	0.1
137	0.09
138	0.08
139	0.06
140	0.05
141	0.06
142	0.06
143	0.06
144	0.05
145	0.05
146	0.06
147	0.07
148	0.07
149	0.06
150	0.06
151	0.06
152	0.06
153	0.06
154	0.09
155	0.09
156	0.11
157	0.13
158	0.14
159	0.15
160	0.15
161	0.15
162	0.13
163	0.12
164	0.13
165	0.14
166	0.13
167	0.12
168	0.13
169	0.12
170	0.1
171	0.1
172	0.07
173	0.05
174	0.05
175	0.05
176	0.04
177	0.04
178	0.04
179	0.04
180	0.04
181	0.04
182	0.04
183	0.07
184	0.11
185	0.12
186	0.14
187	0.17
188	0.18
189	0.26
190	0.28
191	0.29
192	0.27
193	0.34
194	0.34
195	0.32
196	0.31
197	0.24
198	0.21
199	0.19
200	0.21
201	0.16
202	0.13
203	0.12
204	0.12
205	0.12
206	0.12
207	0.11
208	0.07
209	0.05
210	0.05
211	0.05
212	0.06
213	0.07
214	0.1
215	0.1
216	0.1
217	0.11
218	0.11
219	0.13
220	0.14
221	0.14
222	0.1
223	0.1
224	0.11
225	0.13
226	0.16
227	0.15
228	0.15
229	0.15
230	0.17
231	0.17
232	0.18
233	0.18
234	0.21
235	0.24
236	0.25
237	0.24
238	0.24
239	0.23
240	0.21
241	0.19
242	0.12
243	0.07
244	0.06
245	0.05
246	0.04
247	0.03
248	0.03
249	0.03
250	0.03
251	0.04
252	0.04
253	0.07
254	0.1
255	0.12
256	0.13
257	0.14
258	0.15
259	0.16
260	0.16
261	0.17
262	0.15
263	0.14
264	0.14
265	0.14
266	0.13
267	0.13
268	0.12
269	0.09
270	0.07
271	0.06
272	0.04
273	0.04
274	0.04
275	0.03
276	0.03
277	0.03
278	0.06
279	0.06
280	0.06
281	0.06
282	0.06
283	0.05
284	0.06
285	0.06
286	0.04
287	0.05
288	0.05
289	0.04
290	0.05
291	0.05
292	0.06
293	0.06
294	0.06
295	0.06
296	0.07
297	0.07
298	0.08
299	0.08
300	0.07
301	0.06
302	0.08
303	0.07
304	0.07
305	0.16
306	0.21
307	0.28
308	0.29
309	0.29
310	0.33
311	0.41
312	0.48
313	0.48
314	0.45
315	0.41
316	0.4
317	0.4
318	0.36
319	0.27
320	0.21
321	0.12
322	0.1
323	0.08
324	0.07
325	0.06
326	0.06
327	0.06
328	0.06
329	0.05
330	0.06
331	0.07
332	0.07
333	0.08
334	0.11
335	0.15
336	0.17
337	0.17
338	0.19
339	0.25
340	0.25
341	0.26
342	0.23
343	0.21
344	0.2
345	0.19
346	0.17
347	0.1
348	0.1
349	0.07
350	0.07
351	0.05
352	0.04
353	0.06
354	0.05
355	0.06
356	0.07
357	0.06
358	0.07
359	0.07
360	0.07
361	0.07
362	0.07
363	0.06
364	0.06
365	0.06
366	0.06
367	0.06
368	0.05
369	0.05
370	0.05
371	0.05
372	0.05
373	0.08
374	0.1
375	0.12
376	0.16
377	0.17
378	0.17
379	0.17
380	0.17
381	0.13
382	0.11
383	0.09
384	0.05
385	0.04
386	0.04
387	0.05
388	0.05
389	0.06
390	0.07
391	0.07
392	0.08
393	0.11
394	0.17
395	0.18
396	0.19
397	0.2
398	0.19
399	0.18
400	0.2
401	0.18
402	0.13
403	0.11
404	0.1
405	0.09
406	0.09
407	0.09
408	0.06
409	0.05
410	0.06
411	0.06
412	0.07
413	0.12
414	0.17
415	0.19
416	0.25
417	0.3
418	0.39
419	0.43
420	0.49
421	0.46
422	0.46
423	0.49
424	0.47
425	0.43
426	0.34
427	0.29
428	0.23
429	0.2
430	0.16
431	0.1
432	0.06
433	0.05
434	0.04
435	0.03
436	0.03
437	0.03
438	0.02
439	0.02
440	0.02
441	0.02
442	0.02
443	0.02
444	0.02
445	0.02
446	0.03
447	0.03
448	0.04
449	0.04
450	0.04
451	0.05
452	0.05
453	0.05
454	0.05
455	0.05
456	0.05
457	0.05
458	0.04
459	0.03
460	0.03
461	0.03
462	0.03
463	0.03
464	0.03
465	0.03
466	0.03
467	0.05
468	0.05
469	0.05
470	0.06
471	0.06
472	0.06
473	0.07
474	0.08
475	0.09
476	0.16
477	0.25
478	0.29
479	0.36
480	0.4
481	0.4
482	0.44
483	0.44
484	0.4
485	0.37
486	0.39
487	0.39
488	0.41
489	0.41
490	0.37
491	0.41
492	0.47
493	0.45
494	0.45

A1CJI4

3D AlphaFold-predicted Structure Viewer