Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CJI4

Protein Details
Accession A1CJI4    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
83-116FSDADRKEARKRRGASRRRRRKGAWKKLLWVKQSBasic
NLS Segment(s)
PositionSequence
88-109RKEARKRRGASRRRRRKGAWKK
Subcellular Location(s) plas 23, nucl 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009450  Plno_GlcNAc_GPI2  
Gene Ontology GO:0016020  C:membrane  
GO:0016740  F:transferase activity  
GO:0006506  P:GPI anchor biosynthetic process  
KEGG act:ACLA_035110  -  
Pfam View protein in Pfam  
PF06432  GPI2  
Amino Acid Sequences MPPPPDSPPPIPPPVPVETHPNRTSSLKPPSHLRTLPDPTRLAPEDAYLSSAHLRGRAATASYDDSLRALSSNAAGLRPPPAFSDADRKEARKRRGASRRRRRKGAWKKLLWVKQSYPDNYTDTETFLDHLQRNPRVRPYDFWPLVADSTVIVQHVCSVAIFVCCFVGIVKGRVSPVSVVCWGSVGTAVGWILWDSWVWREHHAETSRNAERATEGDDGSSSSSVSSSVHPSSSGPGPLSGPRPSPGQGHGQVHGLGLTMAPNESGELLRRRSTGFGGDTYGLADPGASLSQANGAPGGGGVHPGYLAQENDETAVFSSRNRQRLSTVKSAFLIYFSLLGLSPILKSLTKSTASDSIWAMSCWLLIMNIFSFDYGSGEGAGATKFPASLSTNAAVMASTVLASRLPSTTHVFSLMLFSIEVFGLFPIFRRQLRHFSWTGHVLLTLALVMVAGGAVGMTLRGGWTAAVVGSILGSILTAFAMGGCSWWLISLQKYKNVVTGPWDPARPIIRRQWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.4
4 0.43
5 0.42
6 0.51
7 0.5
8 0.46
9 0.45
10 0.45
11 0.48
12 0.47
13 0.51
14 0.47
15 0.49
16 0.56
17 0.59
18 0.64
19 0.62
20 0.58
21 0.57
22 0.62
23 0.64
24 0.61
25 0.57
26 0.49
27 0.54
28 0.51
29 0.44
30 0.35
31 0.31
32 0.28
33 0.26
34 0.26
35 0.18
36 0.18
37 0.17
38 0.19
39 0.18
40 0.16
41 0.16
42 0.16
43 0.19
44 0.19
45 0.18
46 0.17
47 0.19
48 0.2
49 0.21
50 0.2
51 0.18
52 0.16
53 0.15
54 0.14
55 0.12
56 0.09
57 0.08
58 0.09
59 0.12
60 0.12
61 0.12
62 0.12
63 0.13
64 0.17
65 0.17
66 0.17
67 0.16
68 0.18
69 0.19
70 0.21
71 0.31
72 0.29
73 0.37
74 0.4
75 0.41
76 0.48
77 0.56
78 0.61
79 0.6
80 0.63
81 0.66
82 0.73
83 0.8
84 0.82
85 0.84
86 0.87
87 0.88
88 0.91
89 0.88
90 0.89
91 0.9
92 0.9
93 0.89
94 0.84
95 0.84
96 0.84
97 0.83
98 0.77
99 0.72
100 0.64
101 0.62
102 0.63
103 0.57
104 0.5
105 0.46
106 0.43
107 0.38
108 0.38
109 0.3
110 0.24
111 0.22
112 0.19
113 0.17
114 0.16
115 0.2
116 0.18
117 0.22
118 0.28
119 0.34
120 0.39
121 0.43
122 0.49
123 0.49
124 0.5
125 0.49
126 0.48
127 0.52
128 0.48
129 0.45
130 0.39
131 0.34
132 0.32
133 0.28
134 0.21
135 0.1
136 0.1
137 0.09
138 0.08
139 0.06
140 0.05
141 0.06
142 0.06
143 0.06
144 0.05
145 0.05
146 0.06
147 0.07
148 0.07
149 0.06
150 0.06
151 0.06
152 0.06
153 0.06
154 0.09
155 0.09
156 0.11
157 0.13
158 0.14
159 0.15
160 0.15
161 0.15
162 0.13
163 0.12
164 0.13
165 0.14
166 0.13
167 0.12
168 0.13
169 0.12
170 0.1
171 0.1
172 0.07
173 0.05
174 0.05
175 0.05
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.07
184 0.11
185 0.12
186 0.14
187 0.17
188 0.18
189 0.26
190 0.28
191 0.29
192 0.27
193 0.34
194 0.34
195 0.32
196 0.31
197 0.24
198 0.21
199 0.19
200 0.21
201 0.16
202 0.13
203 0.12
204 0.12
205 0.12
206 0.12
207 0.11
208 0.07
209 0.05
210 0.05
211 0.05
212 0.06
213 0.07
214 0.1
215 0.1
216 0.1
217 0.11
218 0.11
219 0.13
220 0.14
221 0.14
222 0.1
223 0.1
224 0.11
225 0.13
226 0.16
227 0.15
228 0.15
229 0.15
230 0.17
231 0.17
232 0.18
233 0.18
234 0.21
235 0.24
236 0.25
237 0.24
238 0.24
239 0.23
240 0.21
241 0.19
242 0.12
243 0.07
244 0.06
245 0.05
246 0.04
247 0.03
248 0.03
249 0.03
250 0.03
251 0.04
252 0.04
253 0.07
254 0.1
255 0.12
256 0.13
257 0.14
258 0.15
259 0.16
260 0.16
261 0.17
262 0.15
263 0.14
264 0.14
265 0.14
266 0.13
267 0.13
268 0.12
269 0.09
270 0.07
271 0.06
272 0.04
273 0.04
274 0.04
275 0.03
276 0.03
277 0.03
278 0.06
279 0.06
280 0.06
281 0.06
282 0.06
283 0.05
284 0.06
285 0.06
286 0.04
287 0.05
288 0.05
289 0.04
290 0.05
291 0.05
292 0.06
293 0.06
294 0.06
295 0.06
296 0.07
297 0.07
298 0.08
299 0.08
300 0.07
301 0.06
302 0.08
303 0.07
304 0.07
305 0.16
306 0.21
307 0.28
308 0.29
309 0.29
310 0.33
311 0.41
312 0.48
313 0.48
314 0.45
315 0.41
316 0.4
317 0.4
318 0.36
319 0.27
320 0.21
321 0.12
322 0.1
323 0.08
324 0.07
325 0.06
326 0.06
327 0.06
328 0.06
329 0.05
330 0.06
331 0.07
332 0.07
333 0.08
334 0.11
335 0.15
336 0.17
337 0.17
338 0.19
339 0.25
340 0.25
341 0.26
342 0.23
343 0.21
344 0.2
345 0.19
346 0.17
347 0.1
348 0.1
349 0.07
350 0.07
351 0.05
352 0.04
353 0.06
354 0.05
355 0.06
356 0.07
357 0.06
358 0.07
359 0.07
360 0.07
361 0.07
362 0.07
363 0.06
364 0.06
365 0.06
366 0.06
367 0.06
368 0.05
369 0.05
370 0.05
371 0.05
372 0.05
373 0.08
374 0.1
375 0.12
376 0.16
377 0.17
378 0.17
379 0.17
380 0.17
381 0.13
382 0.11
383 0.09
384 0.05
385 0.04
386 0.04
387 0.05
388 0.05
389 0.06
390 0.07
391 0.07
392 0.08
393 0.11
394 0.17
395 0.18
396 0.19
397 0.2
398 0.19
399 0.18
400 0.2
401 0.18
402 0.13
403 0.11
404 0.1
405 0.09
406 0.09
407 0.09
408 0.06
409 0.05
410 0.06
411 0.06
412 0.07
413 0.12
414 0.17
415 0.19
416 0.25
417 0.3
418 0.39
419 0.43
420 0.49
421 0.46
422 0.46
423 0.49
424 0.47
425 0.43
426 0.34
427 0.29
428 0.23
429 0.2
430 0.16
431 0.1
432 0.06
433 0.05
434 0.04
435 0.03
436 0.03
437 0.03
438 0.02
439 0.02
440 0.02
441 0.02
442 0.02
443 0.02
444 0.02
445 0.02
446 0.03
447 0.03
448 0.04
449 0.04
450 0.04
451 0.05
452 0.05
453 0.05
454 0.05
455 0.05
456 0.05
457 0.05
458 0.04
459 0.03
460 0.03
461 0.03
462 0.03
463 0.03
464 0.03
465 0.03
466 0.03
467 0.05
468 0.05
469 0.05
470 0.06
471 0.06
472 0.06
473 0.07
474 0.08
475 0.09
476 0.16
477 0.25
478 0.29
479 0.36
480 0.4
481 0.4
482 0.44
483 0.44
484 0.4
485 0.37
486 0.39
487 0.39
488 0.41
489 0.41
490 0.37
491 0.41
492 0.47
493 0.45
494 0.45