Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6S986

Protein Details
Accession A0A2Z6S986    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
87-113IKMEEEREKERKKKDQEKRKKTIYIGIBasic
NLS Segment(s)
PositionSequence
93-107REKERKKKDQEKRKK
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MSGINPSIDHVSSFNNTPTQDTAVAPDVGDKYENSRHLNYGQTDQKKPNESRNQSARRYSASSDTKPVLIHTFQEEILGGLTGDDFIKMEEEREKERKKKDQEKRKKTIYIGINVFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.22
5 0.23
6 0.23
7 0.22
8 0.2
9 0.21
10 0.2
11 0.2
12 0.17
13 0.18
14 0.15
15 0.14
16 0.15
17 0.12
18 0.14
19 0.19
20 0.23
21 0.25
22 0.25
23 0.27
24 0.28
25 0.33
26 0.3
27 0.31
28 0.35
29 0.37
30 0.39
31 0.42
32 0.45
33 0.48
34 0.48
35 0.52
36 0.54
37 0.53
38 0.57
39 0.63
40 0.65
41 0.61
42 0.63
43 0.54
44 0.47
45 0.44
46 0.37
47 0.36
48 0.34
49 0.31
50 0.31
51 0.3
52 0.28
53 0.25
54 0.25
55 0.2
56 0.15
57 0.14
58 0.14
59 0.14
60 0.13
61 0.13
62 0.12
63 0.1
64 0.09
65 0.08
66 0.05
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.06
75 0.06
76 0.08
77 0.13
78 0.16
79 0.23
80 0.32
81 0.4
82 0.46
83 0.56
84 0.64
85 0.7
86 0.78
87 0.82
88 0.84
89 0.87
90 0.9
91 0.91
92 0.91
93 0.87
94 0.8
95 0.78
96 0.74
97 0.72