Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QTV9

Protein Details
Accession A0A2Z6QTV9    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-32NKRSNRSTITEKKRRHWNAHKKIAIIHydrophilic
NLS Segment(s)
PositionSequence
18-21KKRR
Subcellular Location(s) nucl 17, mito_nucl 12.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR007889  HTH_Psq  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF04218  CENP-B_N  
Amino Acid Sequences MGRPQANKRSNRSTITEKKRRHWNAHKKIAIIMYHENGHSKNKTAAKFNIQTNQLYNWISKKPQLLKVQPDVKRLNTRVKPKYPALETALLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.72
3 0.74
4 0.71
5 0.73
6 0.79
7 0.81
8 0.81
9 0.82
10 0.82
11 0.83
12 0.88
13 0.83
14 0.73
15 0.67
16 0.61
17 0.51
18 0.43
19 0.35
20 0.26
21 0.24
22 0.23
23 0.22
24 0.18
25 0.22
26 0.19
27 0.17
28 0.21
29 0.26
30 0.27
31 0.31
32 0.32
33 0.34
34 0.38
35 0.39
36 0.39
37 0.35
38 0.34
39 0.31
40 0.3
41 0.26
42 0.22
43 0.21
44 0.18
45 0.19
46 0.19
47 0.21
48 0.26
49 0.29
50 0.37
51 0.44
52 0.48
53 0.52
54 0.6
55 0.66
56 0.63
57 0.65
58 0.61
59 0.59
60 0.62
61 0.59
62 0.6
63 0.59
64 0.65
65 0.68
66 0.71
67 0.71
68 0.69
69 0.74
70 0.67
71 0.65
72 0.6