Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RFB3

Protein Details
Accession A0A2Z6RFB3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
80-101IDISPFRRRSSRTPKGRRVLRRBasic
NLS Segment(s)
PositionSequence
86-101RRRSSRTPKGRRVLRR
Subcellular Location(s) nucl 16, cyto_nucl 11.833, mito_nucl 10.333, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MEKRFWFWTSFGQDLDKCPKRPIVQLSNTGYMMLFDKLHGRDRRPLSHFHRDRDVLISCSRNNWCPIMDYIMNAHGSSFIDISPFRRRSSRTPKGRRVLRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.45
3 0.43
4 0.38
5 0.4
6 0.45
7 0.43
8 0.49
9 0.53
10 0.52
11 0.51
12 0.57
13 0.58
14 0.55
15 0.52
16 0.45
17 0.36
18 0.27
19 0.22
20 0.15
21 0.1
22 0.08
23 0.12
24 0.13
25 0.22
26 0.24
27 0.26
28 0.33
29 0.37
30 0.44
31 0.42
32 0.49
33 0.48
34 0.56
35 0.58
36 0.52
37 0.53
38 0.47
39 0.45
40 0.41
41 0.35
42 0.26
43 0.24
44 0.25
45 0.19
46 0.23
47 0.23
48 0.22
49 0.23
50 0.22
51 0.19
52 0.19
53 0.2
54 0.21
55 0.19
56 0.18
57 0.17
58 0.18
59 0.18
60 0.16
61 0.15
62 0.1
63 0.11
64 0.11
65 0.1
66 0.07
67 0.09
68 0.09
69 0.14
70 0.23
71 0.25
72 0.26
73 0.32
74 0.36
75 0.45
76 0.56
77 0.62
78 0.64
79 0.72
80 0.8
81 0.85