Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QTC7

Protein Details
Accession A0A2Z6QTC7    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
33-58GGSNTTPKDKKKKKAAEKSVEKKVNNHydrophilic
NLS Segment(s)
PositionSequence
40-52KDKKKKKAAEKSV
Subcellular Location(s) nucl 21.5, cyto_nucl 14.833, cyto 5
Family & Domain DBs
Amino Acid Sequences MSEQRPPTADEELIDVNMENANDDQPIPPQPSGGSNTTPKDKKKKKAAEKSVEKKVNNIRDIFVYDVPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.14
3 0.1
4 0.11
5 0.1
6 0.08
7 0.07
8 0.07
9 0.07
10 0.08
11 0.08
12 0.09
13 0.12
14 0.14
15 0.13
16 0.13
17 0.13
18 0.15
19 0.18
20 0.18
21 0.18
22 0.19
23 0.21
24 0.27
25 0.31
26 0.34
27 0.42
28 0.49
29 0.55
30 0.63
31 0.71
32 0.76
33 0.83
34 0.88
35 0.88
36 0.9
37 0.89
38 0.89
39 0.86
40 0.75
41 0.72
42 0.7
43 0.69
44 0.62
45 0.56
46 0.47
47 0.42
48 0.45
49 0.41
50 0.34