Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L4N6

Protein Details
Accession E2L4N6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-99GSTLSQGKSKKAKKKVGFRSDRPDLYHydrophilic
NLS Segment(s)
PositionSequence
81-89KSKKAKKKV
Subcellular Location(s) cyto_nucl 14.833, cyto 12.5, nucl 12, mito_nucl 7.165
Family & Domain DBs
KEGG mpr:MPER_00674  -  
Amino Acid Sequences MHLDVEGGVSERRTTPSSNTLDVATSSTIQDAGEPKARFANVEVEIEEKAEEETPVTAISVATGVEKMGISPEGSTLSQGKSKKAKKKVGFRSDRPDLYDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.29
4 0.33
5 0.34
6 0.33
7 0.3
8 0.29
9 0.27
10 0.24
11 0.16
12 0.13
13 0.11
14 0.1
15 0.1
16 0.08
17 0.1
18 0.1
19 0.12
20 0.18
21 0.18
22 0.19
23 0.21
24 0.21
25 0.2
26 0.19
27 0.22
28 0.16
29 0.17
30 0.17
31 0.15
32 0.15
33 0.15
34 0.13
35 0.08
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.06
58 0.06
59 0.07
60 0.09
61 0.09
62 0.11
63 0.11
64 0.13
65 0.18
66 0.19
67 0.26
68 0.33
69 0.42
70 0.5
71 0.59
72 0.68
73 0.72
74 0.81
75 0.86
76 0.87
77 0.88
78 0.87
79 0.86
80 0.85
81 0.79