Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6R3D9

Protein Details
Accession A0A2Z6R3D9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
37-68TFQPVLTKNQKKKLRKKAKKQQHKQLSIPQTSHydrophilic
NLS Segment(s)
PositionSequence
46-58QKKKLRKKAKKQQ
Subcellular Location(s) nucl 20.5, cyto_nucl 14.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MEVVEFTKINPSNYAAAYSSTDYSDSSDEGEKMLKNTFQPVLTKNQKKKLRKKAKKQQHKQLSIPQTSTPKHKQPQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.2
3 0.19
4 0.2
5 0.19
6 0.18
7 0.15
8 0.15
9 0.13
10 0.14
11 0.13
12 0.11
13 0.11
14 0.11
15 0.1
16 0.1
17 0.12
18 0.11
19 0.11
20 0.12
21 0.12
22 0.11
23 0.13
24 0.14
25 0.14
26 0.15
27 0.16
28 0.24
29 0.32
30 0.4
31 0.44
32 0.52
33 0.6
34 0.68
35 0.77
36 0.79
37 0.82
38 0.84
39 0.89
40 0.91
41 0.93
42 0.95
43 0.95
44 0.94
45 0.94
46 0.91
47 0.86
48 0.85
49 0.83
50 0.77
51 0.69
52 0.63
53 0.6
54 0.55
55 0.58
56 0.56
57 0.57