Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QKX6

Protein Details
Accession A0A2Z6QKX6    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
38-94LSKPSKKDKKTVPSKTRPTKSNKPAKDIKKTSKKSKNKKKSKKSSDKKSQDKMDIVKBasic
NLS Segment(s)
PositionSequence
39-85SKPSKKDKKTVPSKTRPTKSNKPAKDIKKTSKKSKNKKKSKKSSDKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MTFNFNHNDQDYSHPWCKAPSSANSKVFTNKSKSSSILSKPSKKDKKTVPSKTRPTKSNKPAKDIKKTSKKSKNKKKSKKSSDKKSQDKMDIVKLLLQLLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.34
4 0.35
5 0.32
6 0.34
7 0.34
8 0.39
9 0.46
10 0.51
11 0.51
12 0.5
13 0.52
14 0.51
15 0.48
16 0.45
17 0.42
18 0.4
19 0.4
20 0.4
21 0.38
22 0.4
23 0.39
24 0.42
25 0.45
26 0.49
27 0.52
28 0.62
29 0.66
30 0.62
31 0.64
32 0.63
33 0.66
34 0.69
35 0.75
36 0.74
37 0.75
38 0.83
39 0.85
40 0.82
41 0.78
42 0.76
43 0.76
44 0.76
45 0.76
46 0.7
47 0.67
48 0.7
49 0.71
50 0.73
51 0.71
52 0.72
53 0.73
54 0.77
55 0.81
56 0.83
57 0.85
58 0.86
59 0.89
60 0.9
61 0.9
62 0.94
63 0.94
64 0.95
65 0.96
66 0.96
67 0.96
68 0.96
69 0.96
70 0.95
71 0.94
72 0.92
73 0.89
74 0.85
75 0.81
76 0.75
77 0.71
78 0.64
79 0.55
80 0.49
81 0.41