Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QHX4

Protein Details
Accession A0A2Z6QHX4    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
130-159DVDNTNTSRNKKNERKKSGRISNQSRKGNNHydrophilic
NLS Segment(s)
PositionSequence
139-151NKKNERKKSGRIS
Subcellular Location(s) nucl 23, cyto_nucl 14.333, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSTTPDFESMQKEIEELKHPQQNRQFEMVPEKAEKSQTPETKSIVKPTGNYTNIAKVLKLNNEEFNGYKSNIRDIVEACPPKKQKKETEVSSKKNKVVIPRDKNKVVASSSKTVENLSDDKSDNNDDNVDVDNTNTSRNKKNERKKSGRISNQSRKGNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.26
4 0.32
5 0.36
6 0.37
7 0.45
8 0.5
9 0.55
10 0.54
11 0.55
12 0.49
13 0.46
14 0.52
15 0.47
16 0.42
17 0.36
18 0.34
19 0.31
20 0.32
21 0.3
22 0.29
23 0.36
24 0.38
25 0.4
26 0.41
27 0.42
28 0.46
29 0.47
30 0.46
31 0.42
32 0.38
33 0.34
34 0.37
35 0.43
36 0.37
37 0.37
38 0.32
39 0.32
40 0.33
41 0.32
42 0.26
43 0.2
44 0.23
45 0.25
46 0.26
47 0.24
48 0.24
49 0.24
50 0.26
51 0.23
52 0.22
53 0.2
54 0.17
55 0.18
56 0.15
57 0.17
58 0.18
59 0.18
60 0.17
61 0.16
62 0.18
63 0.22
64 0.24
65 0.22
66 0.26
67 0.29
68 0.34
69 0.39
70 0.43
71 0.45
72 0.5
73 0.58
74 0.59
75 0.67
76 0.69
77 0.7
78 0.74
79 0.7
80 0.64
81 0.6
82 0.55
83 0.52
84 0.53
85 0.57
86 0.57
87 0.61
88 0.65
89 0.63
90 0.64
91 0.56
92 0.5
93 0.42
94 0.39
95 0.35
96 0.33
97 0.33
98 0.32
99 0.31
100 0.27
101 0.26
102 0.23
103 0.2
104 0.18
105 0.2
106 0.18
107 0.19
108 0.22
109 0.24
110 0.22
111 0.21
112 0.19
113 0.16
114 0.17
115 0.18
116 0.16
117 0.13
118 0.12
119 0.14
120 0.14
121 0.19
122 0.22
123 0.25
124 0.32
125 0.4
126 0.51
127 0.58
128 0.69
129 0.75
130 0.81
131 0.87
132 0.88
133 0.92
134 0.92
135 0.92
136 0.91
137 0.91
138 0.91
139 0.91