Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QTY7

Protein Details
Accession A0A2Z6QTY7    Localization Confidence High Confidence Score 27
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPNKKKRKRGLETEQSKYDEBasic
91-117GTSAKDKTKRFREKLKEKKKAKIKKLMBasic
143-169SLTVIPKKRNHLKKDSSKEKKMNQLNFHydrophilic
NLS Segment(s)
PositionSequence
4-9KKKRKR
94-115AKDKTKRFREKLKEKKKAKIKK
149-160KKRNHLKKDSSK
Subcellular Location(s) nucl 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR026680  CCDC137  
Amino Acid Sequences MPNKKKRKRGLETEQSKYDEPPTSDKTSDIPKNFKRLLLANKFKKQVVNNSKMNKDTSQKVQRIPGESFLGFSRRLDDHMRPDILKAMKEGTSAKDKTKRFREKLKEKKKAKIKKLMEEVNIKDFDDFKDKIKFGEIVQAPPSLTVIPKKRNHLKKDSSKEKKMNQLNFANKRIIAEERERVMAQYRLIKTRKLINKNSYSKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.75
3 0.66
4 0.57
5 0.51
6 0.46
7 0.4
8 0.4
9 0.4
10 0.41
11 0.4
12 0.39
13 0.37
14 0.41
15 0.46
16 0.45
17 0.48
18 0.48
19 0.56
20 0.57
21 0.55
22 0.5
23 0.49
24 0.53
25 0.54
26 0.6
27 0.6
28 0.65
29 0.67
30 0.65
31 0.64
32 0.58
33 0.59
34 0.58
35 0.57
36 0.58
37 0.61
38 0.63
39 0.6
40 0.59
41 0.52
42 0.46
43 0.43
44 0.45
45 0.48
46 0.48
47 0.49
48 0.53
49 0.52
50 0.52
51 0.48
52 0.42
53 0.36
54 0.31
55 0.29
56 0.23
57 0.22
58 0.18
59 0.16
60 0.16
61 0.13
62 0.16
63 0.19
64 0.21
65 0.25
66 0.29
67 0.31
68 0.28
69 0.28
70 0.3
71 0.28
72 0.25
73 0.19
74 0.16
75 0.15
76 0.16
77 0.17
78 0.14
79 0.2
80 0.21
81 0.25
82 0.3
83 0.33
84 0.4
85 0.49
86 0.57
87 0.55
88 0.63
89 0.69
90 0.73
91 0.82
92 0.84
93 0.84
94 0.8
95 0.83
96 0.83
97 0.83
98 0.8
99 0.79
100 0.75
101 0.73
102 0.76
103 0.72
104 0.67
105 0.63
106 0.57
107 0.51
108 0.45
109 0.36
110 0.29
111 0.24
112 0.21
113 0.2
114 0.19
115 0.18
116 0.23
117 0.23
118 0.23
119 0.25
120 0.25
121 0.19
122 0.27
123 0.25
124 0.21
125 0.23
126 0.23
127 0.21
128 0.2
129 0.2
130 0.11
131 0.12
132 0.16
133 0.22
134 0.3
135 0.35
136 0.44
137 0.54
138 0.63
139 0.69
140 0.72
141 0.76
142 0.78
143 0.84
144 0.86
145 0.86
146 0.86
147 0.87
148 0.84
149 0.83
150 0.81
151 0.77
152 0.74
153 0.74
154 0.74
155 0.73
156 0.7
157 0.63
158 0.54
159 0.49
160 0.43
161 0.38
162 0.33
163 0.32
164 0.35
165 0.34
166 0.37
167 0.35
168 0.34
169 0.35
170 0.32
171 0.3
172 0.32
173 0.34
174 0.39
175 0.41
176 0.44
177 0.43
178 0.5
179 0.56
180 0.57
181 0.63
182 0.64
183 0.73