Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6SF23

Protein Details
Accession A0A2Z6SF23    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
19-44KINLNNDNRRSRRKPPKYCPDCKETDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MPLKNDDTRTHGTPYQVHKINLNNDNRRSRRKPPKYCPDCKETDDCIKHFSNKVNRIEEVVNDFHKKCSKSKIEKCSIFNVKFTLNNVPCELKYDLSEFSLDNLQKLAISTTQNCNNFSSKNNLLLRQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.49
4 0.47
5 0.46
6 0.5
7 0.54
8 0.56
9 0.58
10 0.57
11 0.59
12 0.69
13 0.7
14 0.74
15 0.72
16 0.75
17 0.77
18 0.79
19 0.83
20 0.83
21 0.88
22 0.88
23 0.92
24 0.86
25 0.81
26 0.75
27 0.68
28 0.63
29 0.57
30 0.56
31 0.5
32 0.46
33 0.44
34 0.4
35 0.39
36 0.36
37 0.38
38 0.38
39 0.42
40 0.47
41 0.45
42 0.43
43 0.43
44 0.41
45 0.34
46 0.29
47 0.23
48 0.2
49 0.19
50 0.19
51 0.19
52 0.23
53 0.24
54 0.22
55 0.29
56 0.36
57 0.44
58 0.53
59 0.61
60 0.66
61 0.69
62 0.69
63 0.69
64 0.68
65 0.59
66 0.51
67 0.43
68 0.36
69 0.32
70 0.31
71 0.32
72 0.26
73 0.27
74 0.27
75 0.28
76 0.26
77 0.29
78 0.28
79 0.19
80 0.19
81 0.19
82 0.18
83 0.17
84 0.18
85 0.13
86 0.13
87 0.19
88 0.17
89 0.15
90 0.15
91 0.14
92 0.13
93 0.14
94 0.14
95 0.11
96 0.15
97 0.18
98 0.25
99 0.33
100 0.36
101 0.37
102 0.38
103 0.38
104 0.37
105 0.36
106 0.37
107 0.33
108 0.39
109 0.42