Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6S2Z7

Protein Details
Accession A0A2Z6S2Z7    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
34-55MKSNIKKQFRSWKKSRNSDLKYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0004386  F:helicase activity  
Amino Acid Sequences MKFNEHPIVCLPPINFYTYKIKFKMDEKKIYDKMKSNIKKQFRSWKKSRNSDLKYNYITFLKMLLRLQQICNHTELYKRQINDADSNMNNEKLAALKISVSNNKSCYMFSKLLTTPTITPCKHIFDKDCIKVSFEDEPFSCLIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.25
4 0.34
5 0.37
6 0.43
7 0.4
8 0.42
9 0.41
10 0.49
11 0.56
12 0.55
13 0.58
14 0.58
15 0.65
16 0.7
17 0.71
18 0.69
19 0.65
20 0.63
21 0.64
22 0.65
23 0.64
24 0.66
25 0.69
26 0.7
27 0.7
28 0.75
29 0.75
30 0.77
31 0.78
32 0.78
33 0.79
34 0.82
35 0.84
36 0.83
37 0.79
38 0.79
39 0.75
40 0.72
41 0.65
42 0.57
43 0.49
44 0.39
45 0.33
46 0.24
47 0.2
48 0.15
49 0.13
50 0.13
51 0.15
52 0.17
53 0.18
54 0.2
55 0.22
56 0.23
57 0.22
58 0.23
59 0.2
60 0.17
61 0.19
62 0.2
63 0.21
64 0.23
65 0.22
66 0.23
67 0.25
68 0.27
69 0.27
70 0.26
71 0.25
72 0.22
73 0.26
74 0.25
75 0.22
76 0.19
77 0.16
78 0.14
79 0.1
80 0.1
81 0.07
82 0.06
83 0.07
84 0.1
85 0.14
86 0.19
87 0.21
88 0.23
89 0.25
90 0.27
91 0.26
92 0.24
93 0.24
94 0.26
95 0.26
96 0.24
97 0.28
98 0.27
99 0.3
100 0.3
101 0.29
102 0.25
103 0.29
104 0.36
105 0.3
106 0.34
107 0.33
108 0.39
109 0.4
110 0.43
111 0.41
112 0.43
113 0.52
114 0.55
115 0.59
116 0.53
117 0.51
118 0.47
119 0.46
120 0.45
121 0.36
122 0.35
123 0.28
124 0.3