Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RXK9

Protein Details
Accession A0A2Z6RXK9    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MASLKKKFTPRPDKNETVKTYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 7, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008906  HATC_C_dom  
IPR012337  RNaseH-like_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF05699  Dimer_Tnp_hAT  
Amino Acid Sequences MASLKKKFTPRPDKNETVKTYLMLVYGESYEENDDDEITDDDIPSAEEEDEISRYIKLQDIRIKDDPLMWWSNHKDSFPTLVQLAKKYLSIPSTLMLSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.76
4 0.71
5 0.61
6 0.52
7 0.45
8 0.36
9 0.29
10 0.19
11 0.15
12 0.1
13 0.09
14 0.09
15 0.07
16 0.07
17 0.07
18 0.07
19 0.08
20 0.07
21 0.06
22 0.06
23 0.08
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.06
31 0.05
32 0.05
33 0.04
34 0.04
35 0.05
36 0.05
37 0.06
38 0.06
39 0.07
40 0.06
41 0.07
42 0.07
43 0.1
44 0.11
45 0.17
46 0.22
47 0.25
48 0.31
49 0.34
50 0.34
51 0.31
52 0.31
53 0.27
54 0.26
55 0.25
56 0.19
57 0.22
58 0.25
59 0.3
60 0.31
61 0.3
62 0.27
63 0.26
64 0.32
65 0.27
66 0.26
67 0.21
68 0.24
69 0.26
70 0.26
71 0.27
72 0.23
73 0.22
74 0.21
75 0.24
76 0.21
77 0.2
78 0.19
79 0.18