Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6S027

Protein Details
Accession A0A2Z6S027    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
44-71RVNSLPSGKKSRKSQKNKIIKNKQKDQLHydrophilic
NLS Segment(s)
PositionSequence
50-67SGKKSRKSQKNKIIKNKQ
Subcellular Location(s) nucl 22, cyto_nucl 15, cyto 4
Family & Domain DBs
Amino Acid Sequences MPVPQQELNISDTSEKPDSTIDLEPSCMIMENIPKISFSSSKARVNSLPSGKKSRKSQKNKIIKNKQKDQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.18
4 0.17
5 0.18
6 0.19
7 0.21
8 0.17
9 0.16
10 0.17
11 0.16
12 0.16
13 0.14
14 0.11
15 0.08
16 0.07
17 0.09
18 0.1
19 0.11
20 0.11
21 0.11
22 0.11
23 0.13
24 0.12
25 0.14
26 0.2
27 0.23
28 0.28
29 0.29
30 0.32
31 0.32
32 0.35
33 0.39
34 0.4
35 0.41
36 0.41
37 0.5
38 0.52
39 0.57
40 0.64
41 0.67
42 0.7
43 0.74
44 0.81
45 0.82
46 0.88
47 0.91
48 0.92
49 0.93
50 0.92
51 0.92