Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QSB2

Protein Details
Accession A0A2Z6QSB2    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
59-81ILDAKRKRKKTAMNKKAKKLGLKBasic
NLS Segment(s)
PositionSequence
59-78ILDAKRKRKKTAMNKKAKKL
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR044044  DUF5679  
Pfam View protein in Pfam  
PF18930  DUF5679  
Amino Acid Sequences MTEIYCVKCKKKTETSSEVHDMTDKGRYRIHGDCIICGTHKNTLTGENWEVKTHSKKEILDAKRKRKKTAMNKKAKKLGLKILDANENVQTYIKRYLRNATKEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.69
3 0.7
4 0.69
5 0.61
6 0.51
7 0.43
8 0.35
9 0.27
10 0.31
11 0.25
12 0.21
13 0.23
14 0.24
15 0.27
16 0.3
17 0.34
18 0.33
19 0.31
20 0.3
21 0.3
22 0.28
23 0.24
24 0.22
25 0.18
26 0.16
27 0.17
28 0.17
29 0.16
30 0.18
31 0.19
32 0.21
33 0.22
34 0.21
35 0.2
36 0.2
37 0.2
38 0.2
39 0.24
40 0.23
41 0.25
42 0.24
43 0.24
44 0.3
45 0.38
46 0.41
47 0.47
48 0.54
49 0.61
50 0.66
51 0.7
52 0.68
53 0.67
54 0.71
55 0.72
56 0.74
57 0.74
58 0.77
59 0.82
60 0.85
61 0.86
62 0.81
63 0.76
64 0.69
65 0.68
66 0.63
67 0.58
68 0.54
69 0.49
70 0.5
71 0.44
72 0.4
73 0.33
74 0.27
75 0.23
76 0.21
77 0.18
78 0.17
79 0.26
80 0.28
81 0.29
82 0.32
83 0.41
84 0.49