Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QHZ9

Protein Details
Accession A0A2Z6QHZ9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-37AGVDRWPWPKRPKKFWPRPNANKVLIHydrophilic
NLS Segment(s)
PositionSequence
21-25KRPKK
Subcellular Location(s) mito 13, mito_nucl 11.833, nucl 9.5, cyto_mito 8.833
Family & Domain DBs
Amino Acid Sequences MLKQCWHVGRLAGVDRWPWPKRPKKFWPRPNANKVLISYLAIFHAKKVLAAAKCQHCAKVTALDFNRSRDVTNCDIADIRLKREQFSYGLTTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.27
3 0.33
4 0.33
5 0.36
6 0.43
7 0.51
8 0.6
9 0.68
10 0.75
11 0.78
12 0.86
13 0.89
14 0.9
15 0.91
16 0.92
17 0.91
18 0.88
19 0.8
20 0.71
21 0.62
22 0.54
23 0.43
24 0.33
25 0.24
26 0.16
27 0.14
28 0.13
29 0.12
30 0.09
31 0.11
32 0.09
33 0.09
34 0.1
35 0.13
36 0.13
37 0.15
38 0.21
39 0.23
40 0.27
41 0.28
42 0.29
43 0.25
44 0.26
45 0.25
46 0.27
47 0.24
48 0.28
49 0.29
50 0.34
51 0.35
52 0.35
53 0.38
54 0.31
55 0.31
56 0.26
57 0.31
58 0.28
59 0.31
60 0.28
61 0.25
62 0.25
63 0.25
64 0.31
65 0.27
66 0.27
67 0.29
68 0.29
69 0.3
70 0.31
71 0.34
72 0.27
73 0.3