Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RHJ9

Protein Details
Accession A0A2Z6RHJ9    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-46STNFATNRKKFKMKFRSKKDPHQSIVIHydrophilic
154-185KLQSKRDQIYGKRNKRKRYRLHHVMLRIHKKIBasic
NLS Segment(s)
PositionSequence
28-38KKFKMKFRSKK
165-173KRNKRKRYR
Subcellular Location(s) nucl 17.5, mito_nucl 11.5, cyto 5, mito 4.5
Family & Domain DBs
Amino Acid Sequences METPYDIRDEAMNDLLKGYSTNFATNRKKFKMKFRSKKDPHQSIVIHSKHWGKSRGEYSFLPKMKSAEPLPNKLEYDSRLVVNQLGEFYLCIPRPLEIRAENQGPMFQKEGSGVISLDPGVRTFMMGYDPSGMAVEWGKNDIGRIYRLYHAYDKLQSKRDQIYGKRNKRKRYRLHHVMLRIHKKIRCLVNDCNYKLVKWLCENYCIILLPEFRTQEMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.17
4 0.16
5 0.14
6 0.14
7 0.14
8 0.2
9 0.22
10 0.32
11 0.41
12 0.49
13 0.56
14 0.59
15 0.67
16 0.67
17 0.75
18 0.77
19 0.79
20 0.82
21 0.83
22 0.87
23 0.86
24 0.91
25 0.91
26 0.89
27 0.81
28 0.78
29 0.69
30 0.65
31 0.67
32 0.57
33 0.47
34 0.41
35 0.45
36 0.41
37 0.46
38 0.45
39 0.38
40 0.45
41 0.51
42 0.5
43 0.47
44 0.44
45 0.45
46 0.47
47 0.46
48 0.4
49 0.34
50 0.34
51 0.31
52 0.34
53 0.3
54 0.31
55 0.34
56 0.38
57 0.39
58 0.4
59 0.39
60 0.35
61 0.35
62 0.27
63 0.28
64 0.23
65 0.21
66 0.18
67 0.18
68 0.18
69 0.16
70 0.14
71 0.09
72 0.08
73 0.07
74 0.06
75 0.07
76 0.1
77 0.09
78 0.09
79 0.09
80 0.1
81 0.11
82 0.12
83 0.15
84 0.13
85 0.16
86 0.19
87 0.2
88 0.2
89 0.19
90 0.2
91 0.18
92 0.17
93 0.16
94 0.12
95 0.11
96 0.11
97 0.11
98 0.09
99 0.09
100 0.07
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.06
113 0.06
114 0.07
115 0.08
116 0.08
117 0.08
118 0.08
119 0.07
120 0.06
121 0.07
122 0.07
123 0.06
124 0.07
125 0.07
126 0.07
127 0.07
128 0.09
129 0.1
130 0.11
131 0.12
132 0.14
133 0.17
134 0.19
135 0.22
136 0.23
137 0.24
138 0.26
139 0.3
140 0.35
141 0.37
142 0.42
143 0.41
144 0.43
145 0.45
146 0.48
147 0.49
148 0.5
149 0.56
150 0.61
151 0.69
152 0.74
153 0.77
154 0.82
155 0.85
156 0.88
157 0.88
158 0.88
159 0.88
160 0.88
161 0.9
162 0.87
163 0.84
164 0.83
165 0.82
166 0.8
167 0.75
168 0.72
169 0.64
170 0.61
171 0.6
172 0.59
173 0.57
174 0.55
175 0.58
176 0.61
177 0.68
178 0.65
179 0.65
180 0.58
181 0.49
182 0.5
183 0.45
184 0.4
185 0.37
186 0.44
187 0.39
188 0.44
189 0.44
190 0.4
191 0.38
192 0.34
193 0.28
194 0.24
195 0.24
196 0.23
197 0.27
198 0.26